Recombinant Human Regenerating Islet-Derived Protein 1-α, REG1A (C-6His)

Contact us
Catalog number: C530
Price: 869 €
Supplier: DL elisas
Product name: Recombinant Human Regenerating Islet-Derived Protein 1-α, REG1A (C-6His)
Quantity: 96T
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Regenerating Islet-Derived Protein 1-alpha is produced by our Mammalian expression system and the target gene encoding Gln23-Asn166 is expressed with a 6His tag at the C-terminus
Molecular Weight: 17, 31 kD
UniProt number: P05451
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKNVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: REG1A (C-6His), Regenerating Islet-Derived Protein 1-&alpha
Short name: REG1A (C-6His), Recombinant Regenerating Islet-Derived Protein 1-&alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: REG1A (C-6His), sapiens Regenerating Islet-Derived Protein 1-&alpha, recombinant H
Alternative technique: rec
Identity: 9951
Gene: REG1A | More about : REG1A
Long gene name: regenerating family member 1 alpha
Synonyms gene: REG
Synonyms gene name: pancreatic thread protein) , regenerating islet-derived 1 alpha (pancreatic stone protein
Synonyms: PSP PTP PSPS PSPS1
Synonyms name: pancreatic stone protein pancreatic thread protein
Locus: 2p12
Discovery year: 1992-06-05
Entrez gene record: 5967
Pubmed identfication: 2332435 8333731
RefSeq identity: NM_002909
Classification: C-type lectin domain containing
Havana BLAST/BLAT: OTTHUMG00000130016

Related Products :

C530 Recombinant Human Regenerating Islet-Derived Protein 1-α, REG1A (C-6His) 1 mg 2283 € novo human
AE22529HU-48 ELISA test for Human Regenerating Islet-derived 1 Alpha/pancreatic Stone Protein/pancreatic Thread Protein (REG1A) 1x plate of 48 wells 402 € abebio human
AE22529HU Human Regenerating Islet-derived 1 Alpha/pancreatic Stone Protein/pancreatic Thread Protein (REG1A) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE22529HU-96 Human Regenerating Islet-derived 1 Alpha/pancreatic Stone Protein/pancreatic Thread Protein (REG1A) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-REG1a-Hu Human Regenerating Islet Derived Protein 1 Alpha REG1a ELISA Kit 96T 869 € DL elisas human
GENTAUR-58bdc18394a2d Anti- Regenerating Islet Derived Protein 1 Alpha (REG1a) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc1840abb0 Anti- Regenerating Islet Derived Protein 1 Alpha (REG1a) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdce8e05f76 Anti- Regenerating Islet Derived Protein 1 Alpha (REG1a) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bddbec74096 Anti- Regenerating Islet Derived Protein 1 Alpha (REG1a) Antibody 100ug 542 € MBS Polyclonals human
DL-REG1a-Ra Rat Regenerating Islet Derived Protein 1 Alpha REG1a ELISA Kit 96T 962 € DL elisas rat
EKU07038 Regenerating Islet Derived Protein 1 Alpha (REG1a) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU07039 Regenerating Islet Derived Protein 1 Alpha (REG1a) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU07040 Regenerating Islet Derived Protein 1 Alpha (REG1a) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
CC77 Recombinant Human Regenerating Islet-Derived Protein 3-γ, Reg3γ, REG3G (C-6His) 10 µg 202 € novo human
CD30 Recombinant Human Regenerating Islet-Derived Protein 4, RELP (C-6His) 50 µg 303 € novo human
RP-872 Recombinant (E.Coli, His-tag) Human Regenerating islet-derived protein 4 10 μg 333 € adi human
DL-REG3a-Hu Human Regenerating Islet Derived Protein 3 Alpha REG3a ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bdc8bc7e297 Anti- Regenerating Islet Derived Protein 3 Alpha (REG3a) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdccf649405 Anti- Regenerating Islet Derived Protein 3 Alpha (REG3a) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdccf6af349 Anti- Regenerating Islet Derived Protein 3 Alpha (REG3a) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd9a32ea42 Anti- Regenerating Islet Derived Protein 3 Alpha (REG3a) Antibody 100ug 564 € MBS Polyclonals human
E-EL-Ch0144 Chicken REG1α (Regenerating Islet Derived Protein 1 Alpha) ELISA Kit 96T 568 € elabsciences human
DL-REG3a-Mu Mouse Regenerating Islet Derived Protein 3 Alpha REG3a ELISA Kit 96T 921 € DL elisas mouse
DL-REG3a-Ra Rat Regenerating Islet Derived Protein 3 Alpha REG3a ELISA Kit 96T 962 € DL elisas rat
EKU07043 Regenerating Islet Derived Protein 3 Alpha (REG3a) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU07044 Regenerating Islet Derived Protein 3 Alpha (REG3a) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
EKU07045 Regenerating Islet Derived Protein 3 Alpha (REG3a) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
DL-REG1b-Hu Human Regenerating Islet Derived Protein 1 Beta REG1b ELISA Kit 96T 904 € DL elisas human
DL-REG3g-Hu Human Regenerating Islet Derived Protein 3 Gamma REG3g ELISA Kit 96T 904 € DL elisas human
DL-REG4-Hu Human Regenerating Islet Derived Protein 4 REG4 ELISA Kit 96T 869 € DL elisas human