Recombinant Human Aminopeptidase P2, XPNPEP2 (C-6His)

Contact us
Catalog number: C509
Price: 1613 €
Supplier: novo
Product name: Recombinant Human Aminopeptidase P2, XPNPEP2 (C-6His)
Quantity: 500 µg
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Aminopeptidase P2 is produced by our Mammalian expression system and the target gene encoding His22-Ala650 is expressed with a 6His tag at the C-terminus
Molecular Weight: 64 kD, 71
UniProt number: O43895
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAAHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: XPNPEP2 (C-6His), Aminopeptidase P2
Short name: XPNPEP2 (C-6His), Recombinant Aminopeptidase P2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: XPNPEP2 (C-6His), sapiens Aminopeptidase P2, recombinant H
Alternative technique: rec
Identity: 12823
Gene: XPNPEP2 | More about : XPNPEP2
Long gene name: X-prolyl aminopeptidase 2
Synonyms gene name: X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound Xaa-Pro aminopeptidase 2
Locus: Xq26, 1
Discovery year: 1998-02-18
GenBank acession: U90724
Entrez gene record: 7512
Pubmed identfication: 9375790 9628831
RefSeq identity: NM_003399
Classification: Aminopeptidases
Havana BLAST/BLAT: OTTHUMG00000022373
Locus Specific Databases: Mental Retardation database

Related Products :

C509 Recombinant Human Aminopeptidase P2, XPNPEP2 (C-6His) 500 µg 1613 € novo human
MBS616676 X-Prolyl Aminopeptidase (Aminopeptidase P) 1, Soluble [XPNPEPL, X-Prolyl Aminopeptidase (Aminopeptidase P)-like] Antibody 50ug 625 € MBS Polyclonals_1 human
MBS248614 PAb (IgG) to Human XPNPEP2 Antibody 0.05 ml 597 € MBS Polyclonals_1 human
MBS248732 PAb (IgG) to Human XPNPEP2 Antibody 0.05 ml 597 € MBS Polyclonals_1 human
LV359704 XPNPEP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
abx940008 Anti-XPNPEP2 siRNA inquire 50 € abbex human
GWB-MN860E XPNPEP2 antibody 1 vial 521 € genways human
GWB-MN861F Xpnpep2 antibody 1 vial 521 € genways human
MBS272933 XPNPEP2 antibody [N3C3] 100ul 426 € MBS Polyclonals_1 human
GWB-AF800C XPNPEP2 Over-expression Lysate reagent 1 vial 873 € genways human
MBS623856 ARTS1, ID (Endoplasmic Reticulum Aminopeptidase 1, Adipocyte-derived Leucine Aminopeptidase, A-LAP, ARTS-1, Aminopeptidase PILS, Puromycin-insensitive Leucyl-specific Aminopeptidase, PILS-AP, Type 1 Tumor Necrosis Factor Receptor Shedding Aminopeptidase R Antibody 200ul 603 € MBS Polyclonals_1 human
MBS612867 Insulin Regulated Aminopeptidase (IRAP, Placental Leucine Aminopeptidase, PLAP, Leucyl Cystinyl Aminopeptidase, LNPEP, Oxytocinase, Otase, Vesicle Protein of 165kD, vp165) Antibody 0.05 ml 442 € MBS Polyclonals_1 human
CF03 Recombinant Human Methionine Aminopeptidase 1D, MetAP1D, MAP1D (N, C-6His) 500 µg 1613 € novo human
CS75 Recombinant Human Methionine Aminopeptidase 2, METAP2 (N-6His) 50 µg 369 € novo human
C193 Recombinant Human Xaa-Pro Aminopeptidase 1, XPNPEP1 (C-6His) 500 µg 1613 € novo human
CE92 Recombinant Human Xaa-Pro Aminopeptidase P3, XPNPEP3 (N, C-6His) 10 µg 202 € novo human
GWB-B03C1E Aminopeptidase A/Glutamyl Aminopeptidase/ENPEP Goat antibody to or anti-Human Polyclonal (Internal) antibody 1 vial 602 € genways human
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
CC79 Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) 10 µg 146 € novo human
CD98 Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) 500 µg 1613 € novo human
CB01 Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells) 500 µg 1613 € novo human
C848 Recombinant Human 15-PGDH, HPGD (C-6His) 500 µg 1613 € novo human
CI63 Recombinant Human 17β-Hydroxysteroid Dehydrogenase 10, HSD17B10 (C-6His) 1 mg 2486 € novo human
CH76 Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein, OASLOASL (C-6His) 10 µg 202 € novo human
CE05 Recombinant Human 3-Hydroxybutyrate Dehydrogenase Type 2, BDH2, DHRS6 (N-6His) 50 µg 496 € novo human
CH04 Recombinant Human 4-1BB Ligand, 4-1BBL, TNFSF9, CD137L (C-6His) 500 µg 1613 € novo human
CP05 Recombinant Human 4-1BB, TNFRSF9, CD137 (C-6His) 1 mg 1014 € novo human
CJ38 Recombinant Human 4-1BB, TNFRSF9, CD137 (C-Fc-6His) 500 µg 709 € novo human
CE50 Recombinant Human 4-Hydroxyphenylpyruvate Dioxygenase, 4HPPD, HPPDase (N-6His) 10 µg 202 € novo human
CH74 Recombinant Human 40S Ribosomal Protein S7, RPS7 (C-6His) 500 µg 1613 € novo human