Recombinant Human TRAIL R3, TNFRSF10C, CD263 (C-6His)

Contact us
Catalog number: C504
Price: 311 €
Supplier: acr
Product name: Recombinant Human TRAIL R3, TNFRSF10C, CD263 (C-6His)
Quantity: 25 Вµg
Other quantities: 1 mg 1166€ 10 µg 90€ 50 µg 171€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human TRAIL receptor 3 is produced by our Mammalian expression system and the target gene encoding Ala26-Ala221 is expressed with a 6His tag at the C-terminus
Molecular Weight: 21, 78 kD
UniProt number: O14798
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD263 (C-6His), TNFRSF10C, TRAIL R3
Short name: CD263 (C-6His), TNFRSF10C, Recombinant TRAIL R3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD263 (C-6His), decoy without an intracellular domain, member 10c, sapiens TRAIL R3, tumor necrosis factor receptor superfamily, recombinant H
Alternative technique: rec
Alternative to gene target: CD263 and DCR1 and DCR1-TNFR and LIT and TRAIL-R3 and TRAILR3 and TRID, Plasma membranes, TNFRSF10C and IDBG-11572 and ENSG00000173535 and 8794, TRAIL binding, decoy without an intracellular domain, member 10c, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0031225 and anchored component of membrane and cellular component this GO :0045569 and TRAIL binding and molecular function, this GO :0004888 : transmembrane signaling receptor activity, this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005515 : protein binding and also this GO :0045569 : TRAIL binding, this GO :0005515 : protein binding, this GO :0045569 : TRAIL binding, tumor necrosis factor receptor superfamily
Identity: 11906
Gene: TNFRSF10C | More about : TNFRSF10C
Long gene name: TNF receptor superfamily member 10c
Synonyms gene name: decoy without an intracellular domain , member 10c, tumor necrosis factor receptor superfamily
Synonyms: DcR1 TRAILR3 LIT TRID CD263
Locus: 8p21, 3
Discovery year: 1998-12-04
GenBank acession: AF012536
Entrez gene record: 8794
Pubmed identfication: 9314565 9325248
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000097844

Related Products :

C504 Recombinant Human TRAIL R3, TNFRSF10C, CD263 (C-6His) 10 µg 90 € novo human
CD17 Recombinant Human TRAIL R3, TNFRSF10C, CD263 (C-Fc-6His) 500 µg 709 € novo human
RP-1556H Recombinant Human TRAILR3 / TNFRSF10C Protein (His Tag) 20μg 346 € adv human
C326 Recombinant Human TRAIL R2, TNFRSF10B, DR5, CD262 (C-6His) 500 µg 831 € novo human
CD31 Recombinant Human TRAIL R2, TNFRSF10B, DR5, CD262 (C-Fc-6His) 50 µg 202 € novo human
CG92 Recombinant Human TRAIL, TNFSF10, CD253 (Val114-Gly281, C-6His) 1 mg 1674 € novo human
101-M653 Anti-Human TNFRSF10C 100ug 336 € Reliatech antibodies human
GENTAUR-58bca8ffad89f Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C) 100ug 1641 € MBS Recombinant Proteins human
GENTAUR-58bca900086d7 Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C) 1000ug 1641 € MBS Recombinant Proteins human
GENTAUR-58bca90045945 Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C) 100ug 2155 € MBS Recombinant Proteins human
GENTAUR-58bca90092765 Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C) 1000ug 2155 € MBS Recombinant Proteins human
GENTAUR-58bdff6974f57 Anti- TNFRSF10C Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdff6a17927 Anti- TNFRSF10C Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be4171355e0 Anti- TNFRSF10C Antibody 100ug 393 € MBS Polyclonals human
abx216579 Anti-TNFRSF10C Antibody inquire 50 € abbex human
abx937585 Anti-TNFRSF10C siRNA 30 nmol 717 € abbex human
GWB-43C07D TNFRSF10C Over-expression Lysate reagent 1 x 1 vial 562 € genways human
MBS128159 TNFRSF10C Polyclonal Antibody 50ug 304 € MBS Polyclonals_1 human
MBS221822 Anti-HUMAN CD263 100ug 464 € MBS Polyclonals_1 human
GENTAUR-58bde193946ed MOUSE Anti-HUMAN CD263 Antibody 200ug 531 € MBS mono human
GENTAUR-58bde379ca3d0 MOUSE Anti-HUMAN CD263 Antibody 0.025 miligrams 205 € MBS mono human
abx139961 Anti-CD263 Antibody (Azide free) 0.1 mg 412 € abbex human
abx139964 Anti-CD263 Antibody (FITC) inquire 50 € abbex human
abx139963 Anti-CD263 Antibody (PE) inquire 50 € abbex human
AR51875PU-N anti-CD263 / TRAILR3 (26-236, His-tag) Antibody 0,5 mg 1109 € acr human
AR51875PU-S anti-CD263 / TRAILR3 (26-236, His-tag) Antibody 0,1 mg 485 € acr human
AM01323FC-N anti-CD263 / TRAILR3 Antibody 0,1 mg 630 € acr human
AM01323FC-T anti-CD263 / TRAILR3 Antibody 25 Вµg 326 € acr human
AM01323PU-N anti-CD263 / TRAILR3 Antibody 0,2 mg 761 € acr human
AM01323PU-T anti-CD263 / TRAILR3 Antibody 25 Вµg 311 € acr human