| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human LYPD3 is produced by our Mammalian expression system and the target gene encoding Leu31-His286 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
27, 89 kD |
| UniProt number: |
O95274 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
C4, LYPD3, PLAUR Domain Protein 3, 4A (C-6His), Ly6 |
| Short name: |
C4, LYPD3, PLAUR Domain- Protein 3, 4A (C-6His), Recombinant Ly6 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
C4, LYPD3, plasminogen activator, sapiens Ly6, urokinase receptor Domain-Containing Protein 3, 4A (C-6His), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD87 and U-PAR and UPAR and URKR, DNA-templated and biological process this GO :0006501 and C-terminal protein lipidation and biological process this GO :0006928 and cellular component movement and biological process this GO :0006935 and chemotaxis and biological process this GO :0007165 and signal transduction and biological process this GO :0007596 and blood coagulation and biological process this GO :0008270 and zinc ion binding and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016255 and attachment of GPI anchor to protein and biological process this GO :0019898 and extrinsic component of membrane and cellular component this GO :0019899 and enzyme binding and molecular function this GO :0030162 and regulation of proteolysis and biological process this GO :0030377 and U-plasminogen activator receptor activity and molecular function this GO :0031225 and anchored component of membrane and cellular component this GO :0038195 and urokinase plasminogen activator signaling pathway and biological process this GO :0042730 and fibrinolysis and biological process this GO :0043687 and post-translational protein modification and biological process this GO :0044267 and cellular protein metabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, PLAUR and IDBG-55442 and ENSG00000011422 and 5329, PLAUR and IDBG-639118 and ENSBTAG00000013125 and 281983, Plaur and IDBG-154827 and ENSMUSG00000046223 and 18793, U-plasminogen activator receptor activity, nuclei, this GO :0000981 and sequence-specific DNA binding RNA polymerase II transcription factor activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005788 and endoplasmic reticulum lumen and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006355 and regulation of transcription, this GO :0000981 : sequence-specific DNA binding RNA polymerase II transcription factor activity, this GO :0000981 : sequence-specific DNA binding RNA polymerase II transcription factor activity and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0008270 : zinc ion binding and also this GO :0019899 : enzyme binding and also this GO :0030377 : U-plasminogen activator receptor activity, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, this GO :0008270 : zinc ion binding, this GO :0019899 : enzyme binding, this GO :0030377 : U-plasminogen activator receptor activity, urokinase receptor, plasminogen activator |
| Identity: |
24880 |
| Gene: |
LYPD3 |
More about : LYPD3 |
| Long gene name: |
LY6/PLAUR domain containing 3 |
| Synonyms: |
C4, 4A |
| Locus: |
19q13, 31 |
| Discovery year: |
2005-08-30 |
| GenBank acession: |
AF082889 |
| Entrez gene record: |
27076 |
| Pubmed identfication: |
11179665 11245483 |
| RefSeq identity: |
NM_014400 |
| Classification: |
LY6/PLAUR domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000182696 |