Recombinant Human Ly6, PLAUR Domain-Containing Protein 3, LYPD3, C4.4A (C-6His)

Contact us
Catalog number: C487
Price: 2283 €
Supplier: novo
Product name: Recombinant Human Ly6, PLAUR Domain-Containing Protein 3, LYPD3, C4.4A (C-6His)
Quantity: 1 mg
Other quantities: 10 µg 131€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human LYPD3 is produced by our Mammalian expression system and the target gene encoding Leu31-His286 is expressed with a 6His tag at the C-terminus
Molecular Weight: 27, 89 kD
UniProt number: O95274
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: C4, LYPD3, PLAUR Domain Protein 3, 4A (C-6His), Ly6
Short name: C4, LYPD3, PLAUR Domain- Protein 3, 4A (C-6His), Recombinant Ly6
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: C4, LYPD3, plasminogen activator, sapiens Ly6, urokinase receptor Domain-Containing Protein 3, 4A (C-6His), recombinant H
Alternative technique: rec
Alternative to gene target: CD87 and U-PAR and UPAR and URKR, DNA-templated and biological process this GO :0006501 and C-terminal protein lipidation and biological process this GO :0006928 and cellular component movement and biological process this GO :0006935 and chemotaxis and biological process this GO :0007165 and signal transduction and biological process this GO :0007596 and blood coagulation and biological process this GO :0008270 and zinc ion binding and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016255 and attachment of GPI anchor to protein and biological process this GO :0019898 and extrinsic component of membrane and cellular component this GO :0019899 and enzyme binding and molecular function this GO :0030162 and regulation of proteolysis and biological process this GO :0030377 and U-plasminogen activator receptor activity and molecular function this GO :0031225 and anchored component of membrane and cellular component this GO :0038195 and urokinase plasminogen activator signaling pathway and biological process this GO :0042730 and fibrinolysis and biological process this GO :0043687 and post-translational protein modification and biological process this GO :0044267 and cellular protein metabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, PLAUR and IDBG-55442 and ENSG00000011422 and 5329, PLAUR and IDBG-639118 and ENSBTAG00000013125 and 281983, Plaur and IDBG-154827 and ENSMUSG00000046223 and 18793, U-plasminogen activator receptor activity, nuclei, this GO :0000981 and sequence-specific DNA binding RNA polymerase II transcription factor activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005788 and endoplasmic reticulum lumen and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006355 and regulation of transcription, this GO :0000981 : sequence-specific DNA binding RNA polymerase II transcription factor activity, this GO :0000981 : sequence-specific DNA binding RNA polymerase II transcription factor activity and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0008270 : zinc ion binding and also this GO :0019899 : enzyme binding and also this GO :0030377 : U-plasminogen activator receptor activity, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, this GO :0008270 : zinc ion binding, this GO :0019899 : enzyme binding, this GO :0030377 : U-plasminogen activator receptor activity, urokinase receptor, plasminogen activator
Identity: 24880
Gene: LYPD3 | More about : LYPD3
Long gene name: LY6/PLAUR domain containing 3
Synonyms: C4, 4A
Locus: 19q13, 31
Discovery year: 2005-08-30
GenBank acession: AF082889
Entrez gene record: 27076
Pubmed identfication: 11179665 11245483
RefSeq identity: NM_014400
Classification: LY6/PLAUR domain containing
Havana BLAST/BLAT: OTTHUMG00000182696

Related Products :

MBS619030 C4.4A (LYPD3, Y6/PLAUR domain containing 3 GPI-anchored metastasis-associated protein C4.4A homolog, Ly6/PLAUR domain-containing protein 3 precursor, Matrigel-induced gene C4 protein, MIG-C4, UNQ491/PRO1007) 100ug 774 € MBS Polyclonals_1 human
C487 Recombinant Human Ly6, PLAUR Domain-Containing Protein 3, LYPD3, C4.4A (C-6His) 10 µg 131 € novo human
GENTAUR-58bd533a16ef4 Human Ly6/PLAUR domain-containing protein 3 (LYPD3) 100ug 1862 € MBS Recombinant Proteins human
GENTAUR-58bd533a5e513 Human Ly6/PLAUR domain-containing protein 3 (LYPD3) 1000ug 1862 € MBS Recombinant Proteins human
GENTAUR-58bd533ab0126 Human Ly6/PLAUR domain-containing protein 3 (LYPD3) 100ug 2376 € MBS Recombinant Proteins human
GENTAUR-58bd533aead5d Human Ly6/PLAUR domain-containing protein 3 (LYPD3) 1000ug 2376 € MBS Recombinant Proteins human
GENTAUR-58b878c23d527 Rat Ly6/PLAUR domain-containing protein 3 (Lypd3) 100ug 1868 € MBS Recombinant Proteins rat
GENTAUR-58b878c2a04c0 Rat Ly6/PLAUR domain-containing protein 3 (Lypd3) 1000ug 1868 € MBS Recombinant Proteins rat
GENTAUR-58b878c31defa Rat Ly6/PLAUR domain-containing protein 3 (Lypd3) 100ug 2382 € MBS Recombinant Proteins rat
GENTAUR-58b878c37423a Rat Ly6/PLAUR domain-containing protein 3 (Lypd3) 1000ug 2382 € MBS Recombinant Proteins rat
abx251587 Anti-Human Ly6/PLAUR domain-containing protein 3 ELISA Kit inquire 50 € abbex human
RP-0165H Recombinant Human C4.4A / LYPD3 Protein (His Tag) 50μg 624 € adv human
RP-1056M Recombinant Mouse C4.4A / LYPD3 Protein (His Tag) 50μg 624 € adv mouse
GWB-1A0907 GPI-anchored Metastasis-associated protein Homolog (C4.4A) (LYPD3) Rabbit antibody to or anti-Human Polyclonal antibody 1 x 1 vial 602 € genways human
MBS243476 Anti-Human C4.4A / LYPD3 50ug 597 € MBS Polyclonals_1 human
MBS243479 Anti-Human C4.4A / LYPD3 50ug 597 € MBS Polyclonals_1 human
MBS241518 Anti-Human C4.4A / LYPD3 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS243159 Anti-Human C4.4A / LYPD3 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS619211 PR Set7 (SET8, SET Domain Containing 8, SET Domain-containing Protein 8, SET Domain Containing Lysine Methyltransferase 8, SET Domain-containing (Lysine Methyltransferase) 8, SETD8, H4 K20 Specific Histone Methyltransferase, H4-K20-HMTase SETD8, PR/SET Do Antibody 100ul 730 € MBS Polyclonals_1 human
MBS620347 SLP-76, NT (SH2 Domain Containing Leukocyte Protein 76 kD, SH2 Domain-containing Leukocyte Protein of 76kD, SH2 Domain Containing Leukocyte Protein of 76kDa, SLP76, SLP76 Tyrosine Phosphoprotein, SLP-76 Tyrosine Phosphoprotein, 76kD Tyrosine Phosphoprotei 100ug 763 € MBS Polyclonals_1 human
MBS622587 SH2 domain protein 2A (SH2D2A, F2771, SCAP, SH2 domain-containing adapter protein, SH2 domain-containing protein 2A, T cell-specific adapter protein, TSAd, TSAD, VEGF receptor-associated protein, VRAP) 100ug 774 € MBS Polyclonals_1 human
MBS622108 GIPC3 (GIPC PDZ Domain Containing Family Member 3, PDZ Domain-containing Protein GIPC3, PDZ Domain Protein GIPC3) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS612590 Rabenosyn 5 (FYVE-finger-containing Rab5 Effector Protein Rabenosyn-5, Zinc Finger FYVE Domain Containing 20, Zinc Finger FYVE Domain-containing Protein 20, ZFYVE20) 100ug 735 € MBS Polyclonals_1 human
MBS619233 SH2D3A (SH2 Domain Containing 3A, Novel SH2-containing Protein 1, NSP1, SH2 Domain-containing Protein 3A, UNQ175/PRO201) 100ug 591 € MBS Polyclonals_1 human
MBS620754 PLEKHB1 (Pleckstrin homology domain containing, family B (evectins) member 1, KPL1, PHR1, PHRET1, PH domain containing protein in retina 1, PH domain containing, retinal 1) 100ug 591 € MBS Polyclonals_1 human
abx166123 Anti-Secreted Ly6/uPAR Related Protein 1 (Recombinant) 100 μg 876 € abbex human
RP-1452M Recombinant Mouse PLAUR / CD87 / uPAR Protein (His & Fc Tag) 100μg 624 € adv mouse
RP-1451M Recombinant Mouse PLAUR / CD87 / uPAR Protein (His Tag) 20μg 572 € adv mouse
CI22 Recombinant Human Coiled-Coil Domain-Containing Protein 134, CCDC134 (C-6His) 50 µg 303 € novo human
CI80 Recombinant Human CUB Domain-Containing Protein 1, CDCP1, CD318 (C-6His) 1 mg 2283 € novo human