Recombinant Human Leukocyte Ig-Like Receptor B2, LILRB2, ILT4, CD85d (C-6His)

Contact us
Catalog number: C485
Price: 521 €
Supplier: genways
Product name: Recombinant Human Leukocyte Ig-Like Receptor B2, LILRB2, ILT4, CD85d (C-6His)
Quantity: 1 vial
Other quantities: 10 µg 121€ 50 µg 263€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human LILRB2 is produced by our Mammalian expression system and the target gene encoding Gln22-His458 is expressed with a 6His tag at the C-terminus
Molecular Weight: 48, 57 kD
UniProt number: Q8N423
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD85d (C-6His), ILT4, LILRB2, Leukocyte Ig-Like Receptor B2
Short name: CD85d (C-6His), ILT4, LILRB2, Recombinant Leukocyte Ig-Like Receptor B2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD85d (C-6His), ILT4, leukocyte immunoglobulin-like receptor, member 2, sapiens Leukocyte Ig-Like Receptor B2, subfamily B (including TM and ITIM domains), recombinant H
Alternative technique: rec
Alternative to gene target: CD85D and ILT-4 and ILT4 and LIR-2 and LIR2 and MIR-10 and MIR10, Extracellular, LILRB2 and IDBG-68447 and ENSG00000131042 and 10288, cell adhesion molecule binding, member 2, subfamily B (with TM and ITIM domains), this GO :0002578 and negative regulation of antigen processing and presentation and biological process this GO :0002666 and positive regulation of T cell tolerance induction and biological process this GO :0002767 and immune response-inhibiting cell surface receptor signaling pathway and biological process this GO :0002774 and Fc receptor mediated inhibitory signaling pathway and biological process this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0006968 and cellular defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008157 and protein phosphatase 1 binding and molecular function this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0023029 and MHC class Ib protein binding and molecular function this GO :0032396 and inhibitory MHC class I receptor activity and molecular function this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0034113 and heterotypic cell-cell adhesion and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0042288 and MHC class I protein binding and molecular function this GO :0045591 and positive regulation of regulatory T cell differentiation and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0051926 and negative regulation of calcium ion transport and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :2001198 and regulation of dendritic cell differentiation and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0008157 : protein phosphatase 1 binding and also this GO :0023029 : MHC class Ib protein binding and also this GO :0032396 : inhibitory MHC class I receptor activity and also this GO :0042288 : MHC class I protein binding and also this GO :0050839 : cell adhesion molecule binding, this GO :0005515 : protein binding, this GO :0008157 : protein phosphatase 1 binding, this GO :0023029 : MHC class Ib protein binding, this GO :0032396 : inhibitory MHC class I receptor activity, this GO :0042288 : MHC class I protein binding, this GO :0050839 : cell adhesion molecule binding, leukocyte immunoglobulin-like receptor
Identity: 6606
Gene: LILRB2 | More about : LILRB2
Long gene name: leukocyte immunoglobulin like receptor B2
Synonyms gene name: leukocyte immunoglobulin-like receptor, member 2 , subfamily B (with TM and ITIM domains)
Synonyms: LIR-2 ILT4 MIR-10 LIR2 CD85d MIR10
Synonyms name: myeloid inhibitory receptor 10 leucocyte Ig-like receptor B2
Locus: 19q13, 4
Discovery year: 2000-01-11
GenBank acession: AF000574
Pubmed identfication: 9151699 9079806
Classification: Inhibitory leukocyte immunoglobulin like receptors CD molecules
Havana BLAST/BLAT: OTTHUMG00000064896

Related Products :

C485 Recombinant Human Leukocyte Ig-Like Receptor B2, LILRB2, ILT4, CD85d (C-6His) 10 µg 121 € novo human
RP-1005H Recombinant Human LILRB2 / ILT4 / LIR-2 Protein (Fc Tag) 50μg 624 € adv human
RP-1004H Recombinant Human LILRB2 / ILT4 / LIR-2 Protein (His Tag) 20μg 346 € adv human
MBS620347 SLP-76, NT (SH2 Domain Containing Leukocyte Protein 76 kD, SH2 Domain-containing Leukocyte Protein of 76kD, SH2 Domain Containing Leukocyte Protein of 76kDa, SLP76, SLP76 Tyrosine Phosphoprotein, SLP-76 Tyrosine Phosphoprotein, 76kD Tyrosine Phosphoprotei 100ug 763 € MBS Polyclonals_1 human
CA47 Recombinant Human Leukocyte Ig-Like Receptor A2, LILRA2, ILT1, CD85h (C-6His) 50 µg 369 € novo human
CC83 Recombinant Human Leukocyte Ig-Like Receptor A3, LILRA3, ILT6, CD85e (C-6His) 10 µg 146 € novo human
C484 Recombinant Human Leukocyte Ig-Like Receptor B1, LILRB1, ILT2, CD85j (C-6His) 500 µg 1613 € novo human
C574 Recombinant Human Leukocyte Mono Ig-Like Receptor 1, LMIR1, CD300a (C-6His) 50 µg 303 € novo human
CD41 Recombinant Human Leukocyte Mono Ig-Like Receptor 1, LMIR1, CD300a (C-Fc-6His) 10 µg 146 € novo human
C443 Recombinant Human Leukocyte Mono Ig-Like Receptor 2, LMIR2, CD300C (C-6His) 50 µg 273 € novo human
CJ01 Recombinant Human Leukocyte Elastase Inhibitor, Serpin B1, SERPINB1 (C-6His) 1 mg 2283 € novo human
LV205487 LILRB2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV205488 LILRB2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV205489 LILRB2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV205490 LILRB2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV205492 LILRB2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV205491 LILRB2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
RP-879 Recombinant (E.Coli) Human Leukocyte-Associated Ig-Like Receptor 1 5 μg 188 € adi human
CD16 Recombinant Human Leukocyte Mono Ig-Like Receptor 2, LMIR2, CD300C (C-Fc) 50 µg 303 € novo human
MBS615516 APJ Receptor (APLNR, Apelin receptor, AGTRL1, angiotensin II receptor-like 1, Angiotensin receptor-like 1, Apelin receptor, APJ, APJR, FLJ90771, G-protein coupled receptor APJ, HG11, MGC45246) Antibody 0.05 ml 536 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58be12fa1cd5a Anti- LILRB2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be12fa6883c Anti- LILRB2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be131159a16 Anti- LILRB2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be131195121 Anti- LILRB2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be30ad6f498 Anti- LILRB2 Antibody 100ug 658 € MBS Polyclonals human
abx136045 Anti-LILRB2 Antibody 100 µl 398 € abbex human
abx216566 Anti-LILRB2 Antibody 200 μg 369 € abbex human
abx922560 Anti-LILRB2 siRNA 30 nmol 717 € abbex human
GWB-MX015F LILRB2 antibody 1 vial 521 € genways human