| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human LILRB2 is produced by our Mammalian expression system and the target gene encoding Gln22-His458 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
48, 57 kD |
| UniProt number: |
Q8N423 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD85d (C-6His), ILT4, LILRB2, Leukocyte Ig-Like Receptor B2 |
| Short name: |
CD85d (C-6His), ILT4, LILRB2, Recombinant Leukocyte Ig-Like Receptor B2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD85d (C-6His), ILT4, leukocyte immunoglobulin-like receptor, member 2, sapiens Leukocyte Ig-Like Receptor B2, subfamily B (including TM and ITIM domains), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD85D and ILT-4 and ILT4 and LIR-2 and LIR2 and MIR-10 and MIR10, Extracellular, LILRB2 and IDBG-68447 and ENSG00000131042 and 10288, cell adhesion molecule binding, member 2, subfamily B (with TM and ITIM domains), this GO :0002578 and negative regulation of antigen processing and presentation and biological process this GO :0002666 and positive regulation of T cell tolerance induction and biological process this GO :0002767 and immune response-inhibiting cell surface receptor signaling pathway and biological process this GO :0002774 and Fc receptor mediated inhibitory signaling pathway and biological process this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0006968 and cellular defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008157 and protein phosphatase 1 binding and molecular function this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0023029 and MHC class Ib protein binding and molecular function this GO :0032396 and inhibitory MHC class I receptor activity and molecular function this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0034113 and heterotypic cell-cell adhesion and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0042288 and MHC class I protein binding and molecular function this GO :0045591 and positive regulation of regulatory T cell differentiation and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0051926 and negative regulation of calcium ion transport and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :2001198 and regulation of dendritic cell differentiation and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0008157 : protein phosphatase 1 binding and also this GO :0023029 : MHC class Ib protein binding and also this GO :0032396 : inhibitory MHC class I receptor activity and also this GO :0042288 : MHC class I protein binding and also this GO :0050839 : cell adhesion molecule binding, this GO :0005515 : protein binding, this GO :0008157 : protein phosphatase 1 binding, this GO :0023029 : MHC class Ib protein binding, this GO :0032396 : inhibitory MHC class I receptor activity, this GO :0042288 : MHC class I protein binding, this GO :0050839 : cell adhesion molecule binding, leukocyte immunoglobulin-like receptor |
| Identity: |
6606 |
| Gene: |
LILRB2 |
More about : LILRB2 |
| Long gene name: |
leukocyte immunoglobulin like receptor B2 |
| Synonyms gene name: |
leukocyte immunoglobulin-like receptor, member 2 , subfamily B (with TM and ITIM domains) |
| Synonyms: |
LIR-2 ILT4 MIR-10 LIR2 CD85d MIR10 |
| Synonyms name: |
myeloid inhibitory receptor 10 leucocyte Ig-like receptor B2 |
| Locus: |
19q13, 4 |
| Discovery year: |
2000-01-11 |
| GenBank acession: |
AF000574 |
| Pubmed identfication: |
9151699 9079806 |
| Classification: |
Inhibitory leukocyte immunoglobulin like receptors CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000064896 |