| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Nectin-2 is produced by our Mammalian expression system and the target gene encoding Gln32-Leu360 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
36, 58 kD |
| UniProt number: |
Q92692 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPLVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD112 (C-6His), PVRL2, Poliovirus Receptor-Related Protein 2 |
| Short name: |
CD112 (C-6His), PVRL2, Recombinant Poliovirus Receptor- Protein 2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD112 (C-6His), poliovirus receptor-related 2 (herpesvirus entry mediator B), sapiens Poliovirus Receptor-Related Protein 2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD112 and HVEB and PRR2 and PVRR2, Cell surfaces, PVRL2 and IDBG-56684 and ENSG00000130202 and 5819, PVRL2 and IDBG-639286 and ENSBTAG00000015318 and 505580, Pvrl2 and IDBG-152351 and ENSMUSG00000062300 and 19294, binding of host cell surface coreceptor and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0051654 and establishment of mitochondrion localization and biological process this GO :0060370 and susceptibility to T cell mediated cytotoxicity and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, cell adhesion molecule binding, this GO :0001618 and virus receptor activity and molecular function this GO :0001675 and acrosome assembly and biological process this GO :0002860 and positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target and biological process this GO :0002891 and positive regulation of immunoglobulin mediated immune response and biological process this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005911 and cell-cell junction and cellular component this GO :0005915 and zonula adherens and cellular component this GO :0007010 and cytoskeleton organization and biological process this GO :0007156 and homophilic cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007286 and spermatid development and biological process this GO :0007289 and spermatid nucleus differentiation and biological process this GO :0009566 and fertilization and biological process this GO :0009615 and response to virus and biological process this GO :0009986 and cell surface and cellular component this GO :0015026 and coreceptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0019064 and fusion of virus membrane with host plasma membrane and biological process this GO :0030382 and sperm mitochondrion organization and biological process this GO :0032990 and cell part morphogenesis and biological process this GO :0033005 and positive regulation of mast cell activation and biological process this GO :0034329 and cell junction assembly and biological process this GO :0034332 and adherens junction organization and biological process this GO :0042271 and susceptibility to natural killer cell mediated cytotoxicity and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0044406 and adhesion of symbiont to host and biological process this GO :0044782 and cilium organization and biological process this GO :0045216 and cell-cell junction organization and biological process this GO :0045954 and positive regulation of natural killer cell mediated cytotoxicity and biological process this GO :0046814 and virion attachment, this GO :0001618 : virus receptor activity, this GO :0001618 : virus receptor activity and also this GO :0005515 : protein binding and also this GO :0015026 : coreceptor activity and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0050839 : cell adhesion molecule binding, this GO :0005515 : protein binding, this GO :0015026 : coreceptor activity, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, this GO :0050839 : cell adhesion molecule binding, poliovirus receptor-related 2 (herpesvirus entry mediator B) |
| Identity: |
9707 |
| Gene: |
NECTIN2 |
More about : NECTIN2 |
| Long gene name: |
nectin cell adhesion molecule 2 |
| Synonyms gene: |
HVEB PVRL2 |
| Synonyms gene name: |
poliovirus receptor-related 2 (herpesvirus entry mediator B) |
| Synonyms: |
PVRR2 PRR2 CD112 |
| Locus: |
19q13, 32 |
| Discovery year: |
1999-11-15 |
| GenBank acession: |
X80038 |
| Entrez gene record: |
5819 |
| Pubmed identfication: |
7622062 10196354 |
| RefSeq identity: |
NM_002856 |
| Classification: |
C2-set domain containing CD molecules V-set domain containing Immunoglobulin like domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000180839 |