| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
12, 76 kD |
| UniProt number: |
Q07325 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTTVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CXCL9, MIG (C-6His), C-X-C Motif Chemokine 9 |
| Short name: |
CXCL9, MIG (C-6His), Recombinant C-X-C Motif Chemokine 9 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
MIG (C-6His), chemokine (C-X-C motif) ligand 9, sapiens C-X-C Motif Chemokine 9, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CMK and crg-10 and Humig and MIG and SCYB9, CXCL9 and IDBG-25111 and ENSG00000138755 and 4283, CXCL9 and IDBG-643104 and ENSBTAG00000038639 and 513990, CXCR3 chemokine receptor binding, Cxcl9 and IDBG-179870 and ENSMUSG00000029417 and 17329, Extracellular, this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006952 and defense response and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0006968 and cellular defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0009897 and external side of plasma membrane and cellular component this GO :0030816 and positive regulation of cAMP metabolic process and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043950 and positive regulation of cAMP-mediated signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0048248 and CXCR3 chemokine receptor binding and molecular function this GO :0051281 and positive regulation of release of sequestered calcium ion into cytosol and biological process this GO :0051607 and defense response to virus and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0008009 : chemokine activity and also this GO :0048248 : CXCR3 chemokine receptor binding, this GO :0005515 : protein binding, this GO :0008009 : chemokine activity, this GO :0048248 : CXCR3 chemokine receptor binding, chemokine (C-X-C motif) ligand 9 |
| Identity: |
7098 |
| Gene: |
CXCL9 |
More about : CXCL9 |
| Long gene name: |
C-X-C motif chemokine ligand 9 |
| Synonyms gene: |
CMK MIG |
| Synonyms gene name: |
monokine induced by gamma interferon chemokine (C-X-C motif) ligand 9 |
| Synonyms: |
SCYB9 Humig crg-10 |
| Locus: |
4q21, 1 |
| Discovery year: |
1996-05-28 |
| GenBank acession: |
X72755 |
| Entrez gene record: |
4283 |
| Pubmed identfication: |
8476424 9730616 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000160889 |