Recombinant Human Complement Component C1q Receptor, C1QR1, CD93 (C-6His)

Contact us
Catalog number: C405
Price: Ask price €
Supplier: genways bulk
Product name: Recombinant Human Complement Component C1q Receptor, C1QR1, CD93 (C-6His)
Quantity: bulk
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human C1q receptor 1 is produced by our Mammalian expression system and the target gene encoding Ala24-Lys580 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15 kD, 59
UniProt number: Q9NPY3
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: C1QR1, CD93 (C-6His), Complement Component C1q Receptor
Short name: C1QR1, CD93 (C-6His), Recombinant Complement Component C1q Receptor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: C1QR1, CD93 molecule (C-6His), sapiens Complement Component C1q Receptor, recombinant H
Alternative technique: rec
Alternative to gene target: C1qR(P) and C1QR1 and C1qRP and CDw93 and dJ737E23, CD93 and IDBG-59518 and ENSG00000125810 and 22918, CD93 and IDBG-639107 and ENSBTAG00000004207 and 539690, Cd93 and IDBG-208971 and ENSMUSG00000027435 and 17064, Cell surfaces, carbohydrate binding, this GO :0001849 and complement component C1q binding and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006909 and pha this GO cytosis and biological process this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016023 and cytoplasmic membrane-bounded vesicle and cellular component this GO :0016032 and viral process and biological process this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0030246 and carbohydrate binding and molecular function this GO :0042116 and macrophage activation and biological process, this GO :0001849 : complement component C1q binding, this GO :0001849 : complement component C1q binding and also this GO :0004872 : receptor activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0030246 : carbohydrate binding, this GO :0004872 : receptor activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0030246 : carbohydrate binding, 1 and ECSM3 and MXRA4, CD93 molecule
Identity: 15855
Gene: CD93 | More about : CD93
Long gene name: CD93 molecule
Synonyms gene: MXRA4 C1QR1
Synonyms gene name: matrix-remodelling associated 4 complement component 1, q subcomponent, receptor 1 CD93 antigen
Synonyms: C1qRP C1qR(P) dJ737E23, 1 CDw93 ECSM3
Locus: 20p11, 21
Discovery year: 2001-12-05
GenBank acession: U94333
Entrez gene record: 22918
Pubmed identfication: 9047234 10648005
RefSeq identity: NM_012072
Classification: CD molecules C-type lectin domain containing
Havana BLAST/BLAT: OTTHUMG00000032058

Related Products :

C405 Recombinant Human Complement Component C1q Receptor, C1QR1, CD93 (C-6His) 500 µg 1613 € novo human
GENTAUR-58bb40be5b5fb Mouse Complement component C1q receptor (Cd93) 100ug 2514 € MBS Recombinant Proteins mouse
GENTAUR-58bb40beb9138 Mouse Complement component C1q receptor (Cd93) 1000ug 2514 € MBS Recombinant Proteins mouse
GENTAUR-58bb40bf0bc95 Mouse Complement component C1q receptor (Cd93) 100ug 3028 € MBS Recombinant Proteins mouse
GENTAUR-58bb40bf459fd Mouse Complement component C1q receptor (Cd93) 1000ug 3028 € MBS Recombinant Proteins mouse
RP-0379H Recombinant Human CD93 / C1QR1 Protein (His Tag) 20μg 572 € adv human
AR51986PU-N anti-CD93 / C1QR1 (23-572, His-tag) Antibody 0,25 mg 1413 € acr human
AR51986PU-S anti-CD93 / C1QR1 (23-572, His-tag) Antibody 50 Вµg 485 € acr human
AM26516AF-N anti-CD93 / C1QR1 Antibody 0,1 mg 500 € acr human
AM26516RP-N anti-CD93 / C1QR1 Antibody 50 Tests 500 € acr human
BM4030 anti-CD93 / C1QR1 Antibody 0,1 mg 659 € acr human
BM4030B anti-CD93 / C1QR1 Antibody 0,1 mg 717 € acr human
DL-C1qR1-Hu Human Complement Component 1, Q Receptor C1qR1 ELISA Kit 96T 869 € DL elisas human
EKU03373 Complement Component 1, Q Receptor (C1qR1) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
abx250226 Anti-Human Complement component C1q receptor ELISA Kit 96 tests 557 € abbex human
abx255070 Anti-Mouse Complement component C1q receptor ELISA Kit 96 tests 659 € abbex mouse
GENTAUR-58be30136fcf2 C1q Receptor, gamma (gC1qR, C1qBP, Complement component 1, Q subcomponent-binding protein) 100ug 625 € MBS mono human
GENTAUR-58be3013d8470 C1q Receptor, gamma (gC1qR, C1qBP, Complement component 1, Q subcomponent-binding protein) Antibody 100ug 625 € MBS mono human
abx260097 Anti-Complement Component C1q 1 mg 920 € abbex human
ACL7501B C1q Complement Component; Clone: RmC7H8, Rat Mouse Monoclonal antibody-Mouse; Biotin 0.1mg 233 € accurate-monoclonals mouse
ACL7611APC Complement Component C1q, Rat Mouse Monoclonal antibody-Mouse; Clone: MhC5B9, APC conj. 0.1mg 414 € accurate-monoclonals mouse
GENTAUR-58bc5665bf9c2 Saccharomyces cerevisiae Putative uncharacterized protein C1Q_01798 (C1Q_01798) 1000ug 1448 € MBS Recombinant Proteins human
GENTAUR-58bc56661c620 Saccharomyces cerevisiae Putative uncharacterized protein C1Q_01798 (C1Q_01798) 1000ug 1956 € MBS Recombinant Proteins human
GENTAUR-58bb4d3460deb Saccharomyces cerevisiae Uncharacterized protein C1Q_03362 (C1Q_03362) 1000ug 1243 € MBS Recombinant Proteins human
GENTAUR-58bb4d34b0c08 Saccharomyces cerevisiae Uncharacterized protein C1Q_03362 (C1Q_03362) 1000ug 1752 € MBS Recombinant Proteins human
GENTAUR-58bc4df383643 Saccharomyces cerevisiae Vacuolar membrane protein C1Q_01198 (C1Q_01198) 1000ug 1857 € MBS Recombinant Proteins human
GENTAUR-58bc4df42049f Saccharomyces cerevisiae Vacuolar membrane protein C1Q_01198 (C1Q_01198) 1000ug 2365 € MBS Recombinant Proteins human
CH44 Recombinant Human Complement Component C8 γ Chain, C8G (N-6His) 1 mg 2283 € novo human
GWB-5B3B2C Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 1 bulk Ask price € genways bulk human
GWB-96D488 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 3 bulk Ask price € genways bulk human