| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CD83 is produced by our Mammalian expression system and the target gene encoding Thr20-Ala143 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
1 kD, 15 |
| UniProt number: |
Q01151 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HB15 (C-6His), CD83 |
| Short name: |
HB15 (C-6His), Recombinant CD83 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
HB15 (C-6His), sapiens CD83 molecule, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BL11 and HB15, CD83 and IDBG-62750 and ENSG00000112149 and 9308, CD83 and IDBG-636028 and ENSBTAG00000031430 and 617034, Cd83 and IDBG-147707 and ENSMUSG00000015396 and 12522, Cell surfaces, alpha-beta T cell differentiation and biological process, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006952 and defense response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0014070 and response to organic cyclic compound and biological process this GO :0032713 and negative regulation of interleukin-4 production and biological process this GO :0032733 and positive regulation of interleukin-10 production and biological process this GO :0032743 and positive regulation of interleukin-2 production and biological process this GO :0043372 and positive regulation of CD4-positive, this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD83 molecule |
| Identity: |
1703 |
| Gene: |
CD83 |
More about : CD83 |
| Long gene name: |
CD83 molecule |
| Synonyms gene name: |
CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) CD83 molecule |
| Synonyms: |
HB15 BL11 |
| Locus: |
6p23 |
| Discovery year: |
1999-03-26 |
| GenBank acession: |
Z11697 |
| Entrez gene record: |
9308 |
| Pubmed identfication: |
1378080 8422464 |
| Classification: |
CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000014283 |