Recombinant Human CD83, HB15 (C-6His)

Contact us
Catalog number: C403
Price: Ask price €
Supplier: accurate-monoclonals
Product name: Recombinant Human CD83, HB15 (C-6His)
Quantity: vial
Other quantities: 1 mg 2283€ 10 µg 131€ 50 µg 273€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CD83 is produced by our Mammalian expression system and the target gene encoding Thr20-Ala143 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 15
UniProt number: Q01151
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HB15 (C-6His), CD83
Short name: HB15 (C-6His), Recombinant CD83
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: HB15 (C-6His), sapiens CD83 molecule, recombinant H
Alternative technique: rec
Alternative to gene target: BL11 and HB15, CD83 and IDBG-62750 and ENSG00000112149 and 9308, CD83 and IDBG-636028 and ENSBTAG00000031430 and 617034, Cd83 and IDBG-147707 and ENSMUSG00000015396 and 12522, Cell surfaces, alpha-beta T cell differentiation and biological process, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006952 and defense response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0014070 and response to organic cyclic compound and biological process this GO :0032713 and negative regulation of interleukin-4 production and biological process this GO :0032733 and positive regulation of interleukin-10 production and biological process this GO :0032743 and positive regulation of interleukin-2 production and biological process this GO :0043372 and positive regulation of CD4-positive, this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD83 molecule
Identity: 1703
Gene: CD83 | More about : CD83
Long gene name: CD83 molecule
Synonyms gene name: CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) CD83 molecule
Synonyms: HB15 BL11
Locus: 6p23
Discovery year: 1999-03-26
GenBank acession: Z11697
Entrez gene record: 9308
Pubmed identfication: 1378080 8422464
Classification: CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000014283

Related Products :

C403 Recombinant Human CD83, HB15 (C-6His) 50 µg 273 € novo human
CM53 Recombinant Mouse CD83, HB15 (C-6His) 50 µg 232 € novo mouse
CD40 Recombinant Human CD83, HB15 (C-Fc) 1 mg 2283 € novo human
RP-0369H Recombinant Human CD83 / HB15 Protein (His Tag) 50μg 624 € adv human
CM01 Recombinant Mouse CD83, HB15 (C-Fc) 500 µg 1328 € novo mouse
RP-1166M Recombinant Mouse CD83 / HB15 Protein (Fc Tag) 50μg 624 € adv mouse
RP-1165M Recombinant Mouse CD83 / HB15 Protein (His Tag) 50μg 624 € adv mouse
GENTAUR-58bcd9a926e01 Mouse CD83 antigen (Cd83) 100ug 1398 € MBS Recombinant Proteins mouse
GENTAUR-58bcd9a97f34e Mouse CD83 antigen (Cd83) 1000ug 1398 € MBS Recombinant Proteins mouse
GENTAUR-58bcd9a9bc745 Mouse CD83 antigen (Cd83) 100ug 1901 € MBS Recombinant Proteins mouse
GENTAUR-58bcd9aa11b08 Mouse CD83 antigen (Cd83) 1000ug 1901 € MBS Recombinant Proteins mouse
abx262450 Anti-CD83 Protein (Recombinant) 10 µg 340 € abbex human
RP-1057RC Recombinant Cynomolgus CD83 Protein (Fc Tag) 50μg 624 € adv human
RP-2075R Recombinant Rat CD83 Protein (Fc Tag) 50μg 624 € adv rat
RP-2076R Recombinant Rat CD83 Protein (His Tag) 50μg 624 € adv rat
101-M316 Anti-Human CD83 100ug 336 € Reliatech antibodies human
abx151006 Anti-Human CD83 ELISA Kit 96 tests 891 € abbex human
abx575613 Anti-Human CD83 ELISA Kit inquire 50 € abbex human
GWB-PPST13 CD83, 20-144aa Human, His tag, E.coli bulk Ask price € genways bulk human
MEDCLA898-01 CD83, Clone: 1H4b, Mouse Monoclonal antibody-Human 0.1000ul 428 € accurate-monoclonals human
MEDCLA898-1 CD83, Clone: 1H4b, Mouse Monoclonal antibody-Human 1000ul 1081 € accurate-monoclonals human
YSRTMCA1582GA CD83, Clone: HB15A, Mouse Monoclonal antibody-Human 0.1 mg Ask price € accurate-monoclonals human
YSRTMCA1582T CD83, Clone: HB15A, Mouse Monoclonal antibody-Human 20 ug Ask price € accurate-monoclonals human
YSRTMCA1582B CD83, Clone: HB15A, Mouse Monoclonal antibody-Human, Biotin 0.1 mg Ask price € accurate-monoclonals human
YSRTMCA1582BT CD83, Clone: HB15A, Mouse Monoclonal antibody-Human, Biotin 25 ug Ask price € accurate-monoclonals human
YSRTMCA1582F CD83, Clone: HB15A, Mouse Monoclonal antibody-Human, FITC 0.1 mg Ask price € accurate-monoclonals human
YSRTMCA1582FT CD83, Clone: HB15A, Mouse Monoclonal antibody-Human, FITC 25 ug Ask price € accurate-monoclonals human
YSRTMCA1582 CD83, Clone: HB15A, Mouse Monoclonal antibody-Human; frozen, IH/flow/IP 200ug Ask price € accurate-monoclonals human
YSRTMCA1582PE CD83, Clone: HB15A, Mouse Monoclonal antibody-Human, RPE vial Ask price € accurate-monoclonals human
YSRTMCA1582PET CD83, Clone: HB15A, Mouse Monoclonal antibody-Human, RPE vial Ask price € accurate-monoclonals human