| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human High Mobility Group Protein B1 is produced by our Mammalian expression system and the target gene encoding Gly2-Glu215 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
25, 93 kD |
| UniProt number: |
P09429 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
1 mM DTT, 1 mM EDTA, 10% Glycerol, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDEVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HMGB1 (C-6His), Mobility Group Protein B1 |
| Short name: |
HMGB1 (C-6His), Recombinant High Mobility Group Protein B1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
high mobility family box 1 (C-6His), sapiens High Mobility family Protein B1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
DNA binding, DNA ligation and biological process this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006310 and DNA recombination and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006915 and apoptotic process and biological process this GO :0006921 and cellular component disassembly involved in execution phase of apoptosis and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0008301 and DNA binding, HMG1 and HMG3 and SBP-1, HMGB1 and IDBG-21100 and ENSG00000189403 and 3146, HMGB1 and IDBG-630533 and ENSBTAG00000018103 and 282691, Hmgb1 and IDBG-209311 and ENSMUSG00000066551 and 100862258, bending, bending and also this GO :0042056 : chemoattractant activity and also this GO :0044822 : poly(A) RNA binding and also this GO :0050786 : RAGE receptor binding and also this GO :0070491 : repressing transcription factor binding, bending and molecular function this GO :0009986 and cell surface and cellular component this GO :0017053 and transcriptional repressor complex and cellular component this GO :0017055 and negative regulation of RNA polymerase II transcriptional preinitiation complex assembly and biological process this GO :0031175 and neuron projection development and biological process this GO :0033151 and V(D)J recombination and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043388 and positive regulation of DNA binding and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050918 and positive chemotaxis and biological process this GO :0051103 and DNA ligation involved in DNA repair and biological process this GO :0070491 and repressing transcription factor binding and molecular function this GO :2000426 and negative regulation of apoptotic cell clearance and biological process, nuclei, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000793 and condensed chromosome and cellular component this GO :0001773 and myeloid dendritic cell activation and biological process this GO :0002407 and dendritic cell chemotaxis and biological process this GO :0002437 and inflammatory response to antigenic stimulus and biological process this GO :0003677 and DNA binding and molecular function this GO :0003684 and damaged DNA binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003697 and single-stranded DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0006265 and DNA topological change and biological process this GO :0006288 and base-excision repair, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003684 : damaged DNA binding and also this GO :0003690 : double-stranded DNA binding and also this GO :0003697 : single-stranded DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0008134 : transcription factor binding and also this GO :0008301 : DNA binding, this GO :0003684 : damaged DNA binding, this GO :0003690 : double-stranded DNA binding, this GO :0003697 : single-stranded DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005125 : cytokine activity, this GO :0005515 : protein binding, this GO :0008134 : transcription factor binding, this GO :0008301 : DNA binding, this GO :0042056 : chemoattractant activity, this GO :0044822 : poly(A) RNA binding, this GO :0050786 : RAGE receptor binding, this GO :0070491 : repressing transcription factor binding, 15289, 619937, 102642363, high mobility group box 1 |
| Identity: |
4983 |
| Gene: |
HMGB1 |
More about : HMGB1 |
| Long gene name: |
high mobility group box 1 |
| Synonyms gene: |
HMG1 |
| Synonyms gene name: |
high-mobility group (nonhistone chromosomal) protein 1 high-mobility group box 1 |
| Synonyms: |
HMG3 SBP-1 DKFZp686A04236 |
| Synonyms name: |
high mobility group box 1 Sulfoglucuronyl carbohydrate binding protein Amphoterin high mobility group protein 1 |
| Locus: |
13q12, 3 |
| Discovery year: |
1993-12-13 |
| GenBank acession: |
D63874 |
| Entrez gene record: |
3146 |
| Pubmed identfication: |
8661151 11279268 |
| RefSeq identity: |
NM_002128 |
| Classification: |
Canonical high mobility group |
| Havana BLAST/BLAT: |
OTTHUMG00000016670 |