| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Protein FAM3D is produced by our Mammalian expression system and the target gene encoding Tyr26-Phe224 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
12 kD, 23 |
| UniProt number: |
Q96BQ1 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPFVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
Protein FAM3D (C-6His) |
| Short name: |
Recombinant Protein FAM3D (C-6His) |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
member D (C-6His), sapiens Protein family including sequence similarity 3, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, FAM3D and IDBG-42405 and ENSG00000198643 and 131177, FAM3D and IDBG-645182 and ENSBTAG00000023207 and 514459, Oit1 and IDBG-132002 and ENSMUSG00000021749 and 18300, cytokine activity, member D, this GO :0005125 and cytokine activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0046676 and negative regulation of insulin secretion and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity, family with sequence similarity 3 |
| Identity: |
18665 |
| Gene: |
FAM3D |
More about : FAM3D |
| Long gene name: |
family with sequence similarity 3 member D |
| Synonyms gene name: |
family with sequence similarity 3, member D |
| Synonyms: |
EF7 OIT1 |
| Synonyms name: |
Oncoprotein-induced transcript 1 |
| Locus: |
3p14, 2 |
| Discovery year: |
2002-06-18 |
| GenBank acession: |
AF494381 |
| Entrez gene record: |
131177 |
| Pubmed identfication: |
12160727 26966188 |
| RefSeq identity: |
NM_138805 |
| Havana BLAST/BLAT: |
OTTHUMG00000159148 |