| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Protein FAM3C is produced by our Mammalian expression system and the target gene encoding Gln25-Asp227 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
2 kD, 23 |
| UniProt number: |
Q92520 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQDVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
Protein FAM3C (C-6His) |
| Short name: |
Recombinant Protein FAM3C (C-6His) |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
member C (C-6His), sapiens Protein family including sequence similarity 3, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, FAM3C and IDBG-38333 and ENSG00000196937 and 10447, FAM3C and IDBG-634725 and ENSBTAG00000007976 and 615690, Fam3c and IDBG-129573 and ENSMUSG00000029672 and 27999, ILEI, cytokine activity, member C, this GO :0005125 and cytokine activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0007275 and multicellular organismal development and biological process this GO :0008150 and biological process and biological process this GO :0016023 and cytoplasmic membrane-bounded vesicle and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity, family with sequence similarity 3 |
| Identity: |
18664 |
| Gene: |
FAM3C |
More about : FAM3C |
| Long gene name: |
family with sequence similarity 3 member C |
| Synonyms gene name: |
family with sequence similarity 3, member C |
| Synonyms: |
GS3876 ILEI |
| Synonyms name: |
predicted osteoblast protein interleukin-like EMT inducer interleukin-like epithelial-mesenchymal transition inducer |
| Locus: |
7q31, 31 |
| Discovery year: |
2002-06-18 |
| GenBank acession: |
D87120 |
| Entrez gene record: |
10447 |
| Pubmed identfication: |
12160727 |
| RefSeq identity: |
NM_001040020 |
| Havana BLAST/BLAT: |
OTTHUMG00000156979 |