Recombinant Human Endocan, ESM-1 (C-6His)

Contact us
Catalog number: C338
Price: 2486 €
Supplier: novo
Product name: Recombinant Human Endocan, ESM-1 (C-6His)
Quantity: 1 mg
Other quantities: 1 mg 2283€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human ESM-1 is produced by our Mammalian expression system and the target gene encoding Trp20-Arg184 is expressed with a 6His tag at the C-terminus
Molecular Weight: 16 kD, 19
UniProt number: Q9NQ30
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: WSNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPRVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ESM-1 (C-6His), Endocan
Short name: ESM-1 (C-6His), Recombinant Endocan
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ESM-1 (C-6His), sapiens Endocan, recombinant H
Alternative technique: rec

Related Products :

C338 Recombinant Human Endocan, ESM-1 (C-6His) 500 µg 1613 € novo human
CM49 Recombinant Mouse Endothelial Cell-Specific Molecule , Endocan, ESM-1 (C-6His) 10 µg 126 € novo mouse
102-PA44 Anti-Human Endocan/ESM-1 200ug 271 € Reliatech antibodies human
103-M221 Anti-Mouse Endocan/ESM-1 100ug 336 € Reliatech antibodies mouse
RP-0663H Recombinant Human ESM1 / Endocan Protein (His Tag) 20μg 572 € adv human
RP-1276M Recombinant Mouse ESM1 / Endocan Protein (His Tag) 20μg 346 € adv mouse
ICCMES140 Epithelial Sialomucin (ESM), Clone:140C1, Mouse Monoclonal antibody- 1000ul 465 € accurate-monoclonals mouse
CEK1144 anti-Human Endocan ELISA Kit Antibody 96 Tests 703 € acr human
CEK1457 anti-Mouse Endocan ELISA Kit Antibody 96 Tests 703 € acr mouse
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
CC79 Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) 10 µg 146 € novo human
CD98 Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) 500 µg 1613 € novo human
CB01 Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells) 500 µg 1613 € novo human
C848 Recombinant Human 15-PGDH, HPGD (C-6His) 500 µg 1613 € novo human
CI63 Recombinant Human 17β-Hydroxysteroid Dehydrogenase 10, HSD17B10 (C-6His) 1 mg 2486 € novo human
CH76 Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein, OASLOASL (C-6His) 10 µg 202 € novo human
CE05 Recombinant Human 3-Hydroxybutyrate Dehydrogenase Type 2, BDH2, DHRS6 (N-6His) 50 µg 496 € novo human
CH04 Recombinant Human 4-1BB Ligand, 4-1BBL, TNFSF9, CD137L (C-6His) 500 µg 1613 € novo human
CP05 Recombinant Human 4-1BB, TNFRSF9, CD137 (C-6His) 1 mg 1014 € novo human
CJ38 Recombinant Human 4-1BB, TNFRSF9, CD137 (C-Fc-6His) 500 µg 709 € novo human
CE50 Recombinant Human 4-Hydroxyphenylpyruvate Dioxygenase, 4HPPD, HPPDase (N-6His) 10 µg 202 € novo human
CH74 Recombinant Human 40S Ribosomal Protein S7, RPS7 (C-6His) 500 µg 1613 € novo human
C591 Recombinant Human 5-Demethoxyubiquinone Hydroxylase, Mitochondrial, COQ7 (C-6His) 1 mg 2283 € novo human
CH64 Recombinant Human 5-Formyltetrahydrofolate Cyclo-Ligase, MTHFS (C-6His) 1 mg 2486 € novo human
C446 Recombinant Human 5'-Nucleotidase, 5'-NT, CD73 (C-6His) 10 µg 202 € novo human
CG86 Recombinant Human 6-O-Methylguanine-DNA Methyltransferase, MGMT (N-6His) 10 µg 146 € novo human
CI74 Recombinant Human 6-Phosphogluconate Dehydrogenase, Decarboxylating, PGD (C-6His) 500 µg 780 € novo human
CF46 Recombinant Human ACADM, MCAD (N-6His) 1 mg 2283 € novo human
C421 Recombinant Human Acrosomal Protein SP-10, ACRV1 (C-6His) 50 µg 369 € novo human
CF89 Recombinant Human Actin-Related Protein 8, ACTR8 (N-6His) 1 mg 2486 € novo human