Recombinant Human Cystatin F, CST7 (C-6His)

Contact us
Catalog number: C334
Price: 489 €
Supplier: Bioss Polyclonal Antibodies
Product name: Recombinant Human Cystatin F, CST7 (C-6His)
Quantity: 100 microliters
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cystatin F is produced by our Mammalian expression system and the target gene encoding Gly20-His145 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15, 58 kD
UniProt number: O76096
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCHVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CST7 (C-6His), Cystatin F
Short name: CST7 (C-6His), Recombinant Cystatin F
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CST7 (C-6His), sapiens Cystatin F, recombinant H
Alternative technique: rec
Identity: 2479
Gene: CST7 | More about : CST7
Long gene name: cystatin F
Synonyms gene name: cystatin F (leukocystatin)
Synonyms name: leukocystatin
Locus: 20p11, 21
Discovery year: 1998-10-14
GenBank acession: AF036342
Entrez gene record: 8530
Pubmed identfication: 9733783 9632704
RefSeq identity: NM_003650
Classification: Cystatins, type 2
Havana BLAST/BLAT: OTTHUMG00000032108

Related Products :

C334 Recombinant Human Cystatin F, CST7 (C-6His) 50 µg 496 € novo human
CD20 Recombinant Mouse Cystatin F, CST7 (C-6His) 500 µg 1613 € novo mouse
RP-0521H Recombinant Human Cystatin 7 / CST7 Protein 10μg 624 € adv human
RP-0522H Recombinant Human Cystatin 7 / CST7 Protein (Fc Tag) 10μg 624 € adv human
RP-0520H Recombinant Human Cystatin 7 / CST7 Protein (His Tag) 10μg 624 € adv human
RP-1232M Recombinant Mouse Cystatin 7 / CST7 Protein (Fc Tag) 10μg 624 € adv mouse
GENTAUR-58bc74a9aa516 Mouse Cystatin-F (Cst7) 100ug 1437 € MBS Recombinant Proteins mouse
GENTAUR-58bc74a9ed1d4 Mouse Cystatin-F (Cst7) 1000ug 1437 € MBS Recombinant Proteins mouse
GENTAUR-58bc74aa42202 Mouse Cystatin-F (Cst7) 100ug 1940 € MBS Recombinant Proteins mouse
GENTAUR-58bc74aa87407 Mouse Cystatin-F (Cst7) 1000ug 1940 € MBS Recombinant Proteins mouse
C087 Recombinant Human Cystatin A (N-6His) 500 µg 1613 € novo human
CI55 Recombinant Human Cystatin C, CST3 (C-6His) 50 µg 496 € novo human
CE75 Recombinant Human Cystatin C, CST3 (N-6His) 1 mg 2283 € novo human
C397 Recombinant Human Cystatin D, CSTD, CST5 (C-6His) 10 µg 202 € novo human
C333 Recombinant Human Cystatin M, CST6 (C-6His) 10 µg 202 € novo human
C335 Recombinant Human Cystatin S, CST4 (C-6His) 500 µg 1613 € novo human
C336 Recombinant Human Cystatin SA, CST2 (C-6His) 10 µg 202 € novo human
C462 Recombinant Human Cystatin SN, CST1 (C-6His) 1 mg 2283 € novo human
CR02 Recombinant Mouse Cystatin 8, CST8 (N-6His) 50 µg 496 € novo mouse
CD44 Recombinant Mouse Cystatin E, CST6 (C-6His) 10 µg 202 € novo mouse
LV128915 CST7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV128916 CST7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV128917 CST7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV128918 CST7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV128920 CST7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV128919 CST7 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bde8e6bfb5b Anti- CST7 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bde8e73b320 Anti- CST7 Antibody 0.06 ml 265 € MBS Polyclonals human
abx219392 Anti-CST7 Antibody inquire 50 € abbex human
GENTAUR-58be6429da31d Anti-CST7 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human