Recombinant Human Cystatin M, CST6 (C-6His)

Contact us
Catalog number: C333
Price: 348 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Cystatin M, CST6 (C-6His)
Quantity: 0.12 ml
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cystatin E/M is produced by our Mammalian expression system and the target gene encoding Arg29-Met149 is expressed with a 6His tag at the C-terminus
Molecular Weight: 14, 66 kD
UniProt number: Q15828
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 5, 2 um filtered solution of 20 mM MES, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQMLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CST6 (C-6His), Cystatin M
Short name: CST6 (C-6His), Recombinant Cystatin M
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CST6 (C-6His), sapiens Cystatin M, recombinant H
Alternative technique: rec
Identity: 2478
Gene: CST6 | More about : CST6
Long gene name: cystatin E/M
Locus: 11q13, 1
Discovery year: 1996-12-12
GenBank acession: U62800
Entrez gene record: 1474
Pubmed identfication: 9154125 9099741
RefSeq identity: NM_001323
Classification: Cystatins, type 2
Havana BLAST/BLAT: OTTHUMG00000166750

Related Products :

C333 Recombinant Human Cystatin M, CST6 (C-6His) 10 µg 202 € novo human
CD44 Recombinant Mouse Cystatin E, CST6 (C-6His) 10 µg 202 € novo mouse
RP-0505H Recombinant Human Cystatin E / CST6 Protein (His Tag) 10μg 624 € adv human
RP-1234M Recombinant Mouse Cystatin E / CST6 Protein (His Tag) 10μg 624 € adv mouse
abx571075 Anti-Human Cystatin 6 (CST6) ELISA Kit 96 tests 789 € abbex human
DL-CST6-Hu Human Cystatin 6 CST6 ELISA Kit 96T 904 € DL elisas human
EKU03566 Cystatin 6 (CST6) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKC01068 Cystatin-B (CSTB/CST6/STFB) ELISA kit 1 plate of 96 wells 596 € Biomatik ELISA kits human
GWB-P0892H CST6, 29-149aa, Recombinant Protein bulk Ask price € genways bulk human
C087 Recombinant Human Cystatin A (N-6His) 500 µg 1613 € novo human
CI55 Recombinant Human Cystatin C, CST3 (C-6His) 50 µg 496 € novo human
CE75 Recombinant Human Cystatin C, CST3 (N-6His) 1 mg 2283 € novo human
C397 Recombinant Human Cystatin D, CSTD, CST5 (C-6His) 10 µg 202 € novo human
C334 Recombinant Human Cystatin F, CST7 (C-6His) 50 µg 496 € novo human
C335 Recombinant Human Cystatin S, CST4 (C-6His) 500 µg 1613 € novo human
C336 Recombinant Human Cystatin SA, CST2 (C-6His) 10 µg 202 € novo human
C462 Recombinant Human Cystatin SN, CST1 (C-6His) 1 mg 2283 € novo human
CR02 Recombinant Mouse Cystatin 8, CST8 (N-6His) 50 µg 496 € novo mouse
CD20 Recombinant Mouse Cystatin F, CST7 (C-6His) 500 µg 1613 € novo mouse
LV128909 CST6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV128910 CST6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV128911 CST6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV128912 CST6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV128914 CST6 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV128913 CST6 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdf3b869961 Anti- CST6 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf3b8cf50d Anti- CST6 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0e0eec2d9 Anti- CST6 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0e0f495d7 Anti- CST6 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0e4a5f710 Anti- CST6 Antibody 0.12 ml 348 € MBS Polyclonals human