Recombinant Human KIR2DL4, CD158d, KIR103 (C-6His)

Contact us
Catalog number: C310
Price: 202 €
Supplier: novo
Product name: Recombinant Human KIR2DL4, CD158d, KIR103 (C-6His)
Quantity: 10 µg
Other quantities: 1 mg 2283€ 10 µg 131€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human KIR2DL4 is produced by our Mammalian expression system and the target gene encoding Trp22-His242 is expressed with a 6His tag at the C-terminus
Molecular Weight: 25, 34 kD
UniProt number: Q99706
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD158d, KIR103 (C-6His), KIR2DL4
Short name: CD158d, KIR103 (C-6His), Recombinant KIR2DL4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: 4, CD158d, KIR103 (C-6His), large cytoplasmic tail, sapiens killer cellular immunoglobulin-like receptor, two domains, recombinant H
Alternative technique: rec
Alternative to gene target: 4, CD158D and G9P and KIR-103AS and KIR103 and KIR103AS, KIR2DL4 and IDBG-69383 and ENSG00000189013 and 3805, Plasma membranes, long cytoplasmic tail, protein binding, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006968 and cellular defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0016020 and membrane and cellular component this GO :0050776 and regulation of immune response and biological process, this GO :0004888 : transmembrane signaling receptor activity, this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, two domains, killer cell immunoglobulin-like receptor
Identity: 6332
Gene: KIR2DL4 | More about : KIR2DL4
Long gene name: killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4
Synonyms gene name: 4 , killer cell immunoglobulin-like receptor, long cytoplasmic tail, two domains
Synonyms: 103AS 15, 212 CD158D
Locus: 19q13, 42
Discovery year: 1997-11-14
GenBank acession: X97229
Entrez gene record: 3805
Pubmed identfication: 8946682
RefSeq identity: NM_002255
Classification: Killer cell immunoglobulin like receptors CD molecules
Havana BLAST/BLAT: OTTHUMG00000065880
Locus Specific Databases: IPD-KIR Database

Related Products :

C310 Recombinant Human KIR2DL4, CD158d, KIR103 (C-6His) 500 µg 1613 € novo human
RP-0961H Recombinant Human KIR2DL4 / CD158D Protein 50μg 624 € adv human
RP-0962H Recombinant Human KIR2DL4 / CD158D Protein (Fc Tag) 50μg 624 € adv human
AM26033AC-N anti-CD158d / KIR2DL4 Antibody 100 Tests 471 € acr human
AM26033PU-N anti-CD158d / KIR2DL4 Antibody 0,1 mg 427 € acr human
AM26033RP-N anti-CD158d / KIR2DL4 Antibody 100 Tests 471 € acr human
AP52370PU-N anti-CD158d / KIR2DL4 (C-term) Antibody 0,4 ml 587 € acr human
SM6021 anti-CD158d / KIR2DL4 (L1, L3, L4, S4) Antibody 0,1 ml 500 € acr human
SM6021S anti-CD158d / KIR2DL4 (L1, L3, L4, S4) Antibody 50 Вµl 384 € acr human
abx139663 Anti-CD158d Antibody inquire 50 € abbex human
abx139664 Anti-CD158d Antibody (APC) inquire 50 € abbex human
abx139665 Anti-CD158d Antibody (PE) inquire 50 € abbex human
101-M541 Anti-Human KIR2DL4 100ug 336 € Reliatech antibodies human
LV199772 KIR2DL4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV199773 KIR2DL4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV199774 KIR2DL4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV199775 KIR2DL4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV199777 KIR2DL4 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV199776 KIR2DL4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
abx145740 Anti-KIR2DL4 Antibody inquire 50 € abbex human
abx921662 Anti-KIR2DL4 siRNA 15 nmol 528 € abbex human
GWB-MP022D KIR2DL4 antibody 1 vial 521 € genways human
GWB-F8A916 KIR2DL4 Over-expression Lysate reagent 1 vial 562 € genways human
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
CC79 Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) 10 µg 146 € novo human
CD98 Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) 500 µg 1613 € novo human
CB01 Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells) 500 µg 1613 € novo human
C848 Recombinant Human 15-PGDH, HPGD (C-6His) 500 µg 1613 € novo human
CI63 Recombinant Human 17β-Hydroxysteroid Dehydrogenase 10, HSD17B10 (C-6His) 1 mg 2486 € novo human
CH76 Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein, OASLOASL (C-6His) 10 µg 202 € novo human