| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human BMP Receptor II is produced by our Mammalian expression system and the target gene encoding Ser27-Ile151 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
05 kD, 15 |
| UniProt number: |
Q13873 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BMPR2, PPH1 (C-6His), BMP Receptor II |
| Short name: |
BMPR2, PPH1 (C-6His), Recombinant BMP Receptor II |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
PPH1 (C-6His), bone morphogenetic protein receptor, classification II (serine/threonine kinase), sapiens BMP Receptor II, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BMPR-II and BMPR3 and BMR2 and BRK-3 and POVD1 and PPH1 and T-ALK, BMPR2 and IDBG-78880 and ENSG00000204217 and 659, BT, Bmpr2 and IDBG-158574 and ENSMUSG00000067336 and 12168, Extracellular, activin receptor activity, this GO :0001707 and mesoderm formation and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0001946 and lymphangiogenesis and biological process this GO :0001974 and blood vessel remodeling and biological process this GO :0002063 and chondrocyte development and biological process this GO :0003085 and negative regulation of systemic arterial blood pressure and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004675 and transmembrane receptor protein serine/threonine kinase activity and molecular function this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005024 and transforming growth factor beta-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005901 and caveola and cellular component this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0007178 and transmembrane receptor protein serine/threonine kinase signaling pathway and biological process this GO :0007420 and brain development and biological process this GO :0009267 and cellular response to starvation and biological process this GO :0009925 and basal plasma membrane and cellular component this GO :0009952 and anterior/posterior pattern specification and biological process this GO :0009986 and cell surface and cellular component this GO :0010595 and positive regulation of endothelial cell migration and biological process this GO :0010634 and positive regulation of epithelial cell migration and biological process this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0014916 and regulation of lung blood pressure and biological process this GO :0016020 and membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0016362 and activin receptor activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity and also this GO :0004702 : receptor signaling protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005024 : transforming growth factor beta-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016362 : activin receptor activity, this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity, this GO :0004702 : receptor signaling protein serine/threonine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0005024 : transforming growth factor beta-activated receptor activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016362 : activin receptor activity, this GO :0016772 : transferase activity, this GO :0019838 : growth factor binding, this GO :0046872 : metal ion binding, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0019838 : growth factor binding and also this GO :0046872 : metal ion binding, transferring phosphorus-containing groups and molecular function this GO :0019838 and growth factor binding and molecular function this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030425 and dendrite and cellular component this GO :0030501 and positive regulation of bone mineralization and biological process this GO :0030509 and BMP signaling pathway and biological process this GO :0030513 and positive regulation of BMP signaling pathway and biological process this GO :0032924 and activin receptor signaling pathway and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0044214 and fully spanning plasma membrane and cellular component this GO :0045669 and positive regulation of osteoblast differentiation and biological process this GO :0045906 and negative regulation of vasoconstriction and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048010 and vascular endothelial growth factor receptor signaling pathway and biological process this GO :0048286 and lung alveolus development and biological process this GO :0048842 and positive regulation of axon extension involved in axon guidance and biological process this GO :0060041 and retina development in camera-type eye and biological process this GO :0060173 and limb development and biological process this GO :0060836 and lymphatic endothelial cell differentiation and biological process this GO :0060840 and artery development and biological process this GO :0060841 and venous blood vessel development and biological process this GO :0061298 and retina vasculature development in camera-type eye and biological process this GO :1902731 and negative regulation of chondrocyte proliferation and biological process this GO :2000279 and negative regulation of DNA biosynthetic process and biological process, type II, type II (serine/threonine kinase), type II and also this GO :0016772 : transferase activity, type II and molecular function this GO :0016772 and transferase activity, 25715 and IDBG-643309 and ENSBTAG00000006420 and 407127, bone morphogenetic protein receptor |
| Identity: |
1078 |
| Gene: |
BMPR2 |
More about : BMPR2 |
| Long gene name: |
bone morphogenetic protein receptor type 2 |
| Synonyms gene: |
PPH1 |
| Synonyms gene name: |
primary pulmonary hypertension 1 bone morphogenetic protein receptor, type II (serine/threonine kinase) bone morphogenetic protein receptor type II |
| Synonyms: |
BRK-3 T-ALK BMPR3 BMPR-II |
| Locus: |
2q33, 1-q33, 2 |
| Discovery year: |
1997-03-19 |
| GenBank acession: |
Z48923 |
| Entrez gene record: |
659 |
| Pubmed identfication: |
7791754 |
| RefSeq identity: |
NM_001204 |
| Classification: |
Type 2 receptor serine/threonine kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000133617 |
| Locus Specific Databases: |
LRG_712 |