| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human NDRG1 is produced by our E, coli expression system and the target gene encoding Met1-Cys394 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
45 kD |
| UniProt number: |
Q92597 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
DRG-1CAP43 (N-6His), NDRG1, N-myc Downstream Regulated Gene 1 |
| Short name: |
DRG-1CAP43 (N-6His), NDRG1, Recombinant N-myc Downstream Regulated Gene 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
DRG-1CAP43 (N-6His), N-v-myc myelocytomatosis viral oncogene homolog (avian) downstream regulated 1, sapiens N-v-myc myelocytomatosis viral oncogene homolog (avian) Downstream Regulated Gene 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CAP43 and CMT4D and DRG-1 and DRG1 and GC4 and HMSNL and NDR1 and NMSL and PROXY1 and RIT42 and RTP and TARG1 and TDD5, NDRG1 and IDBG-36420 and ENSG00000104419 and 10397, NDRG1 and IDBG-644056 and ENSBTAG00000000711 and 504499, Ndrg1 and IDBG-146853 and ENSMUSG00000005125 and 17988, cadherin binding, nuclei, signal transduction by p53 class mediator and biological process this GO :0032287 and peripheral nervous system myelin maintenance and biological process this GO :0043015 and gamma-tubulin binding and molecular function this GO :0045296 and cadherin binding and molecular function this GO :0045576 and mast cell activation and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0055038 and recycling endosome membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071456 and cellular response to hypoxia and biological process this GO :0090232 and positive regulation of spindle checkpoint and biological process, this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005813 and centrosome and cellular component this GO :0005829 and cytosol and cellular component this GO :0005874 and microtubule and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005913 and cell-cell adherens junction and cellular component this GO :0008017 and microtubule binding and molecular function this GO :0008219 and cell death and biological process this GO :0010038 and response to metal ion and biological process this GO :0015630 and microtubule cytoskeleton and cellular component this GO :0017137 and Rab GTPase binding and molecular function this GO :0030330 and DNA damage response, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008017 : microtubule binding and also this GO :0017137 : Rab GTPase binding and also this GO :0043015 : gamma-tubulin binding and also this GO :0045296 : cadherin binding, this GO :0008017 : microtubule binding, this GO :0017137 : Rab GTPase binding, this GO :0043015 : gamma-tubulin binding, this GO :0045296 : cadherin binding, N-myc downstream regulated 1 |
| Identity: |
7679 |
| Gene: |
NDRG1 |
More about : NDRG1 |
| Long gene name: |
N-myc downstream regulated 1 |
| Synonyms gene: |
CAP43 |
| Synonyms: |
DRG1 RTP TDD5 NDR1 |
| Locus: |
8q24, 22 |
| Discovery year: |
1998-12-23 |
| GenBank acession: |
X92845 |
| Entrez gene record: |
10397 |
| Pubmed identfication: |
9251681 8939898 18455888 |
| Havana BLAST/BLAT: |
OTTHUMG00000164441 |
| Locus Specific Databases: |
Inherited Peripheral Neuropathies Mutation Database LRG_258 |