Recombinant Human N-myc Downstream Regulated Gene 1, NDRG1, DRG-1CAP43 (N-6His)

Contact us
Catalog number: C299
Price: 763 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human N-myc Downstream Regulated Gene 1, NDRG1, DRG-1CAP43 (N-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human NDRG1 is produced by our E, coli expression system and the target gene encoding Met1-Cys394 is expressed with a 6His tag at the N-terminus
Molecular Weight: 45 kD
UniProt number: Q92597
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: DRG-1CAP43 (N-6His), NDRG1, N-myc Downstream Regulated Gene 1
Short name: DRG-1CAP43 (N-6His), NDRG1, Recombinant N-myc Downstream Regulated Gene 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: DRG-1CAP43 (N-6His), N-v-myc myelocytomatosis viral oncogene homolog (avian) downstream regulated 1, sapiens N-v-myc myelocytomatosis viral oncogene homolog (avian) Downstream Regulated Gene 1, recombinant H
Alternative technique: rec
Alternative to gene target: CAP43 and CMT4D and DRG-1 and DRG1 and GC4 and HMSNL and NDR1 and NMSL and PROXY1 and RIT42 and RTP and TARG1 and TDD5, NDRG1 and IDBG-36420 and ENSG00000104419 and 10397, NDRG1 and IDBG-644056 and ENSBTAG00000000711 and 504499, Ndrg1 and IDBG-146853 and ENSMUSG00000005125 and 17988, cadherin binding, nuclei, signal transduction by p53 class mediator and biological process this GO :0032287 and peripheral nervous system myelin maintenance and biological process this GO :0043015 and gamma-tubulin binding and molecular function this GO :0045296 and cadherin binding and molecular function this GO :0045576 and mast cell activation and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0055038 and recycling endosome membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071456 and cellular response to hypoxia and biological process this GO :0090232 and positive regulation of spindle checkpoint and biological process, this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005813 and centrosome and cellular component this GO :0005829 and cytosol and cellular component this GO :0005874 and microtubule and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005913 and cell-cell adherens junction and cellular component this GO :0008017 and microtubule binding and molecular function this GO :0008219 and cell death and biological process this GO :0010038 and response to metal ion and biological process this GO :0015630 and microtubule cytoskeleton and cellular component this GO :0017137 and Rab GTPase binding and molecular function this GO :0030330 and DNA damage response, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008017 : microtubule binding and also this GO :0017137 : Rab GTPase binding and also this GO :0043015 : gamma-tubulin binding and also this GO :0045296 : cadherin binding, this GO :0008017 : microtubule binding, this GO :0017137 : Rab GTPase binding, this GO :0043015 : gamma-tubulin binding, this GO :0045296 : cadherin binding, N-myc downstream regulated 1
Identity: 7679
Gene: NDRG1 | More about : NDRG1
Long gene name: N-myc downstream regulated 1
Synonyms gene: CAP43
Synonyms: DRG1 RTP TDD5 NDR1
Locus: 8q24, 22
Discovery year: 1998-12-23
GenBank acession: X92845
Entrez gene record: 10397
Pubmed identfication: 9251681 8939898 18455888
Havana BLAST/BLAT: OTTHUMG00000164441
Locus Specific Databases: Inherited Peripheral Neuropathies Mutation Database LRG_258

Related Products :

C299 Recombinant Human N-myc Downstream Regulated Gene 1, NDRG1, DRG-1CAP43 (N-6His) 10 µg 202 € novo human
MBS611796 N-myc Downstream Regulated Gene 1 (NDRG1, Cap43, Cmt4d, Differentiation related gene1 protein, drg1, gc4, hmsnl, Human mRNA for RTP complete cds, ndr1, NDRG1 protein, Nickel specific induction protein Cap43, nmsl, Nmyc downstream regulated, Nmyc downstrea Antibody 100ug 735 € MBS Polyclonals_1 human
abx168538 Anti-N-myc Downstream Regulated Gene 2 Protein (Recombinant) 50 μg 644 € abbex human
abx130419 Anti-N-myc Downstream Regulated Gene 2 Antibody 100 μg 601 € abbex human
EKU06321 N-myc Downstream Regulated Gene 2 (NDRG2) ELISA kit 1 plate of 96 wells 972 € Biomatik ELISA kits human
DL-NDRG2-Ra Rat N-myc Downstream Regulated Gene 2 NDRG2 ELISA Kit 96T 1032 € DL elisas rat
GWB-CA69F7 Recombinant Human N-Myc Downstream Regulated 1 bulk Ask price € genways bulk human
abx260466 Anti-N-Myc Downstream Regulated 1 Protein (Recombinant) 50 µg 340 € abbex human
abx260937 Anti-N-Myc Downstream Regulated 2 Protein (Recombinant) 20 µg 340 € abbex human
MBS619634 c-Myc Epitope Tag (Myc, myc-1, Cellular myelocytomatosis oncogene, Myc2, Niard, Nird, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog) Antibody 100ul 558 € MBS Polyclonals_1 human
GENTAUR-58bd7656ae726 Mouse Protein NDRG1 (Ndrg1) 100ug 2111 € MBS Recombinant Proteins mouse
GENTAUR-58bd76570d516 Mouse Protein NDRG1 (Ndrg1) 1000ug 2111 € MBS Recombinant Proteins mouse
GENTAUR-58bd765756980 Mouse Protein NDRG1 (Ndrg1) 100ug 2625 € MBS Recombinant Proteins mouse
GENTAUR-58bd765799b9f Mouse Protein NDRG1 (Ndrg1) 1000ug 2625 € MBS Recombinant Proteins mouse
MBS622875 TORC2 (TORC 2, TORC-2, Transducer of Regulated CREB Protein 2, CREB-regulated Transcription Coactivator 2, CRTC2, Transducer of Regulated cAMP Response Element-binding Protein) Antibody 100ug 785 € MBS Polyclonals_1 human
MBS618426 Arg3.1 (Activity-regulated Cytoskeleton-associated Protein, Activity-regulated Gene 3.1 Protein Homolog, ARG3.1/ARC, ARC/ARG3.1) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS615757 Pax8 (Paired Box Gene 8, Paired Box Homeotic Gene 8, Paired Box Protein Pax8, Paired Box Protein Pax-8, Paired Domain Gene 8, Pax-8, HGNC:8622) 100ug 735 € MBS Polyclonals_1 human
GWB-64F4C0 Downstream Of Tyrosine Kinase 1 (DOK1) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 tube 602 € genways human
C196 Recombinant Human Myc-Associated Factor X, MAX (C-6His) 1 mg 2283 € novo human
RP-1108H Recombinant Human NDRG1 / CAP43 Protein (His Tag) 50μg 572 € adv human
MBS622788 DOCK1 (Dedicator of Cytokinesis 1, Ced5, 180kD Protein Downstream of CRK, DOCK180) Antibody 100ug 763 € MBS Polyclonals_1 human
MBS619106 DOK1, CT (Docking Protein 1 62kD, Downstream Of Tyrosine Kinase 1, MGC117395, MGC138860, p62(dok), P62DOK, pp62) Antibody 100ug 564 € MBS Polyclonals_1 human
MBS623817 DOK2, CT (Docking Protein 2, Downstream Of Tyrosine Kinase 2, p56(dok-2)) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS612992 Dok2, p56 (Docking Protein, Downstream of Tyrosine Kinase, Dok-R, p56Dok2, FRIP, rasGAP-associated docking protein) Antibody 100ug 630 € MBS Polyclonals_1 human
MBS615418 Dok2, p56 (Docking Protein, Downstream of Tyrosine Kinase, Dok-R, p56Dok2, FRIP, rasGAP-associated docking protein) Antibody 100ul 564 € MBS Polyclonals_1 human
MBS615420 Dok2, p56, phosphorylated (Tyr351) (Docking Protein, Downstream of Tyrosine Kinase, Dok-R, p56Dok2, FRIP, rasGAP-associated docking protein) Antibody 100ul 603 € MBS Polyclonals_1 human
MBS611195 DREAM (Downstream Regulatory Element Antagonist Modulator, Calsenilin) Antibody 100ug 525 € MBS Polyclonals_1 human
MBS614062 DREAM (Downstream Regulatory Element Antagonist Modulator, Calsenilin) Antibody 100ug 597 € MBS Polyclonals_1 human
MBS623452 STAP1, NT (F56) (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS619851 STAP1 (Signal Transducing Adaptor Protein 1, STAP 1, STAP-1, BCR Downstream Signaling Protein 1, BRDG1, Docking Protein BRDG1, Signal Transducing Adaptor Family Member 1, Stem Cell Adaptor Protein 1) 100ug 763 € MBS Polyclonals_1 human