Recombinant Human Signaling Threshold-Regulating TM Adapter 1, SIT1 (N-6His)

Contact us
Catalog number: C292
Price: 602 €
Supplier: genways
Product name: Recombinant Human Signaling Threshold-Regulating TM Adapter 1, SIT1 (N-6His)
Quantity: 1 x 1 vial
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: By understanding cell signaling, Errors in cellular information processing are responsible for diseases such as cancer, The ability of cells to perceive and correctly respond to their microenvironment is the basis of development, and diabetes, and immunity as well as normal tissue homeostasis, artificial tissues may be created, autoimmunity, diseases may be treated effectively and, theoretically, tissue repair, Cell nucleus signaling proteins and molecules are part of a complex system of communication that governs basic cellular activities and coordinates cell actions
Molecular Weight: 17, 65 kD
UniProt number: Q9Y3P8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 mM EDTA, 250 mM sodium chloride, pH 8, 0 , 2 um filtered solution of 20 mM Tris, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAASLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SIT1 (N-6His), Signaling Threshold-Regulating TM Adapter 1
Short name: SIT1 (N-6His), Recombinant Signaling Threshold-Regulating TM Adapter 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Signaling Threshold-Regulating TM Adapter 1, signaling threshold regulating transmembrane adaptor 1 (N-6His), recombinant H
Alternative technique: rec
Alternative to gene target: Plasma membranes, SH2 domain binding, SIT1 and IDBG-62762 and ENSG00000137078 and 27240, SIT1 and IDBG-633050 and ENSBTAG00000011411 and 512027, Sit1 and IDBG-141175 and ENSMUSG00000028460 and 54390, this GO :0002376 and immune system process and biological process this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0019900 and kinase binding and molecular function this GO :0042169 and SH2 domain binding and molecular function this GO :0050863 and regulation of T cell activation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0019900 : kinase binding and also this GO :0042169 : SH2 domain binding, this GO :0019900 : kinase binding, this GO :0042169 : SH2 domain binding, signaling threshold regulating transmembrane adaptor 1
Identity: 17710
Gene: SIT1 | More about : SIT1
Long gene name: signaling threshold regulating transmembrane adaptor 1
Synonyms gene name: suppression inducing transmembrane adaptor 1
Synonyms: SIT
Synonyms name: SHP2 interacting transmembrane adaptor
Locus: 9p13, 3
Discovery year: 2005-04-25
Entrez gene record: 27240
Pubmed identfication: 11491537 10209036
RefSeq identity: NM_014450
Havana BLAST/BLAT: OTTHUMG00000019867

Related Products :

C292 Recombinant Human Signaling Threshold-Regulating TM Adapter 1, SIT1 (N-6His) 1 mg 2283 € novo human
GENTAUR-58bdd67c83281 Anti- Signaling Threshold Regulating Transmembrane Adaptor 1 (SIT1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdd67cd6732 Anti- Signaling Threshold Regulating Transmembrane Adaptor 1 (SIT1) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bddbce84e00 Anti- Signaling Threshold Regulating Transmembrane Adaptor 1 (SIT1) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bddd69a0180 Anti- Signaling Threshold Regulating Transmembrane Adaptor 1 (SIT1) Antibody 100ug 564 € MBS Polyclonals human
abx263452 Anti-Signaling Threshold Regulating Transmembrane Adaptor 1 Protein (Recombinant) 1 µg 238 € abbex human
MBS615235 VISA, NT (Virus-Induced Signaling Adapter, Mitochondrial Antiviral Signaling Protein, MAVS, CARD Adapter Inducing Interferon-beta, Cardif, IPS-1) Antibody 100ug 569 € MBS Polyclonals_1 virus
GWB-P0829J SIT1, 1-196aa, Recombinant Protein bulk Ask price € genways bulk human
LV305233 SIT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
C309 Recombinant Human Signaling Lymphocytic Activation Molecule, SLAM, CD150 (C-6His) 50 µg 263 € novo human
abx168131 Anti-Adhesion Regulating Molecule 1 Protein (Recombinant) 10 μg 398 € abbex human
abx904945 Anti-SIT1 siRNA inquire 50 € abbex human
abx933415 Anti-SIT1 siRNA 30 nmol 717 € abbex human
abx933416 Anti-SIT1 siRNA inquire 50 € abbex human
AR39151PU-N anti-SIT1 / SIT (62-196, HIS-Tag) Antibody 50 Вµg 1138 € acr human
AR39151PU-S anti-SIT1 / SIT (62-196, HIS-Tag) Antibody 10 Вµg 485 € acr human
SM3074P anti-SIT1 / SIT Antibody 0,1 mg 398 € acr human
SM3074R anti-SIT1 / SIT Antibody 0,1 mg 587 € acr human
AP53920PU-N anti-SIT1 / SIT (C-term) Antibody 0,4 ml 587 € acr human
MBS422320 Goat anti-SIT1 Antibody 100ug 299 € MBS Polyclonals_1 human
GENTAUR-58bc84923e65e Saccharomyces cerevisiae Siderophore iron transporter 1 (SIT1) 1000ug 2652 € MBS Recombinant Proteins human
GENTAUR-58bc849288f03 Saccharomyces cerevisiae Siderophore iron transporter 1 (SIT1) 1000ug 3161 € MBS Recombinant Proteins human
GWB-CF61F6 SIT1 Over-expression Lysate reagent 1 vial 562 € genways human
MBS619610 ECSIT, CT (Evolutionarily Conserved Signaling Intermediate in Toll Pathway, Evolutionarily Conserved Signaling Intermediate in Toll Pathways, ECSIT Homolog, ECSIT Protein, Signaling Intermediate in Toll Pathway Evolutionarily Conserved, SITPEC, SITPEC Pro Antibody 100ug 580 € MBS Polyclonals_1 human
DL-VISA-Hu Human Virus Induced Signaling Adapter VISA ELISA Kit 96T 904 € DL elisas virus
GWB-8B2290 Virus-induced Signaling Adapter (VISA) Rabbit antibody to or anti-Human Polyclonal (Internal) antibody 1 vial 602 € genways human
GWB-684F71 Virus-induced Signaling Adapter (VISA) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 tube 602 € genways human
abx252047 Anti-Human Apoptosis Signal Regulating Kinase 1 ELISA Kit inquire 50 € abbex human
DL-ASK1-Hu Human Apoptosis Signal Regulating Kinase 1 ASK1 ELISA Kit 96T 869 € DL elisas human
GWB-146B48 MAP/Microtubule Affinity-Regulating Kinase 1 (MARK1) Rabbit antibody to or anti-Human Polyclonal antibody 1 x 1 vial 602 € genways human