| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
By understanding cell signaling, Errors in cellular information processing are responsible for diseases such as cancer, The ability of cells to perceive and correctly respond to their microenvironment is the basis of development, and diabetes, and immunity as well as normal tissue homeostasis, artificial tissues may be created, autoimmunity, diseases may be treated effectively and, theoretically, tissue repair, Cell nucleus signaling proteins and molecules are part of a complex system of communication that governs basic cellular activities and coordinates cell actions |
| Molecular Weight: |
17, 65 kD |
| UniProt number: |
Q9Y3P8 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 mM EDTA, 250 mM sodium chloride, pH 8, 0 , 2 um filtered solution of 20 mM Tris, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAASLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
SIT1 (N-6His), Signaling Threshold-Regulating TM Adapter 1 |
| Short name: |
SIT1 (N-6His), Recombinant Signaling Threshold-Regulating TM Adapter 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
sapiens Signaling Threshold-Regulating TM Adapter 1, signaling threshold regulating transmembrane adaptor 1 (N-6His), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Plasma membranes, SH2 domain binding, SIT1 and IDBG-62762 and ENSG00000137078 and 27240, SIT1 and IDBG-633050 and ENSBTAG00000011411 and 512027, Sit1 and IDBG-141175 and ENSMUSG00000028460 and 54390, this GO :0002376 and immune system process and biological process this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0019900 and kinase binding and molecular function this GO :0042169 and SH2 domain binding and molecular function this GO :0050863 and regulation of T cell activation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0019900 : kinase binding and also this GO :0042169 : SH2 domain binding, this GO :0019900 : kinase binding, this GO :0042169 : SH2 domain binding, signaling threshold regulating transmembrane adaptor 1 |
| Identity: |
17710 |
| Gene: |
SIT1 |
More about : SIT1 |
| Long gene name: |
signaling threshold regulating transmembrane adaptor 1 |
| Synonyms gene name: |
suppression inducing transmembrane adaptor 1 |
| Synonyms: |
SIT |
| Synonyms name: |
SHP2 interacting transmembrane adaptor |
| Locus: |
9p13, 3 |
| Discovery year: |
2005-04-25 |
| Entrez gene record: |
27240 |
| Pubmed identfication: |
11491537 10209036 |
| RefSeq identity: |
NM_014450 |
| Havana BLAST/BLAT: |
OTTHUMG00000019867 |