| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Not all receptor antagonist that bind to enzymes are inhibitors, Since blocking an enzyme's activity can kill a pathogen , activator, caspase, esterase inhibitors , lipoprotein, many drugs are enzyme inhibitors, papain, pathway, peptidase, protease , proteinase, trypsin, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme, , Tissue, acrosin, activity, and decreases its , are , bind to enzymes and increase their , enzymatic activity, enzyme activator ligands or agonists , enzyme receptor , imbalance, metabolic , or correct a , or receptor ligands or receptor antagonists that bind to an , proteins |
| Molecular Weight: |
2 kD, 24 |
| UniProt number: |
P46527 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CDKN1B (N-6His), Cyclin-Dependent Kinase Inhibitor 1B |
| Short name: |
CDKN1B (N-6His), Recombinant Cyclin-Dependent Kinase Inhibitor 1B |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Kip1) (N-6His), cyclin-dependent kinase inhibitor 1B (p27, sapiens Cyclin-Dependent phosphorylation catalyst suppressor 1B, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CDKN1B and IDBG-20317 and ENSG00000111276 and 1027, CDKN1B and IDBG-639416 and ENSBTAG00000018254 and 512613, CDKN4 and KIP1 and MEN1B and MEN4 and P27KIP1, Cdkn1b and IDBG-194318 and ENSMUSG00000003031 and 12576, DNA-templated and biological process this GO :0045930 and negative regulation of mitotic cell cycle and biological process this GO :0046686 and response to cadmium ion and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048102 and autophagic cell death and biological process this GO :0048839 and inner ear development and biological process this GO :0050680 and negative regulation of epithelial cell proliferation and biological process this GO :0051087 and chaperone binding and molecular function this GO :0051271 and negative regulation of cellular component movement and biological process this GO :0060770 and negative regulation of epithelial cell proliferation involved in prostate gland development and biological process this GO :0071236 and cellular response to antibiotic and biological process this GO :0071285 and cellular response to lithium ion and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071850 and mitotic cell cycle arrest and biological process this GO :0071901 and negative regulation of protein serine/threonine kinase activity and biological process, Kip1), cytoplasmic mediator activity, cytoplasmic mediator activity and also this GO :0005515 : protein binding and also this GO :0008656 : cysteine-type endopeptidase activator activity involved in apoptotic process and also this GO :0019903 : protein phosphatase binding and also this GO :0030544 : Hsp70 protein binding and also this GO :0032403 : protein complex binding and also this GO :0051087 : chaperone binding, cytoplasmic mediator activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005768 and endosome and cellular component this GO :0005829 and cytosol and cellular component this GO :0006813 and potassium ion transport and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006977 and DNA damage response, nuclei, signal transduction by p53 class mediator resulting in cell cycle arrest and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007605 and sensory perception of sound and biological process this GO :0008219 and cell death and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0008656 and cysteine-type endopeptidase activator activity involved in apoptotic process and molecular function this GO :0009749 and response to glucose and biological process this GO :0010942 and positive regulation of cell death and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0019903 and protein phosphatase binding and molecular function this GO :0030308 and negative regulation of cell growth and biological process this GO :0030544 and Hsp70 protein binding and molecular function this GO :0031116 and positive regulation of microtubule polymerization and biological process this GO :0032355 and response to estradiol and biological process this GO :0032403 and protein complex binding and molecular function this GO :0033673 and negative regulation of kinase activity and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042326 and negative regulation of phosphorylation and biological process this GO :0042493 and response to drug and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043200 and response to amino acid and biological process this GO :0043234 and protein complex and cellular component this GO :0043434 and response to peptide hormone and biological process this GO :0045087 and innate immune response and biological process this GO :0045732 and positive regulation of protein catabolic process and biological process this GO :0045736 and negative regulation of cyclin-dependent protein serine/threonine kinase activity and biological process this GO :0045892 and negative regulation of transcription, this GO :0000079 and regulation of cyclin-dependent protein serine/threonine kinase activity and biological process this GO :0000082 and G1/S transition of mitotic cell cycle and biological process this GO :0000278 and mitotic cell cycle and biological process this GO :0001666 and response to hypoxia and biological process this GO :0004861 and cyclin-dependent protein serine/threonine kinase inhibitor activity and molecular function this GO :0005072 and transforming growth factor beta receptor, this GO :0004861 : cyclin-dependent protein serine/threonine kinase inhibitor activity, this GO :0004861 : cyclin-dependent protein serine/threonine kinase inhibitor activity and also this GO :0005072 : transforming growth factor beta receptor, this GO :0005072 : transforming growth factor beta receptor, this GO :0005515 : protein binding, this GO :0008656 : cysteine-type endopeptidase activator activity involved in apoptotic process, this GO :0019903 : protein phosphatase binding, this GO :0030544 : Hsp70 protein binding, this GO :0032403 : protein complex binding, this GO :0051087 : chaperone binding, transforming growth factor beta receptor, cyclin-dependent kinase inhibitor 1B (p27 |
| Identity: |
1785 |
| Gene: |
CDKN1B |
More about : CDKN1B |
| Long gene name: |
cyclin dependent kinase inhibitor 1B |
| Synonyms gene name: |
Kip1) , cyclin-dependent kinase inhibitor 1B (p27 |
| Synonyms: |
KIP1 P27KIP1 |
| Locus: |
12p13, 1 |
| Discovery year: |
1995-09-14 |
| GenBank acession: |
AF480891 |
| Entrez gene record: |
1027 |
| Pubmed identfication: |
8033212 |
| RefSeq identity: |
NM_004064 |
| Havana BLAST/BLAT: |
OTTHUMG00000149914 |