Recombinant Human MOB-Like Protein Phocein, MOB4, MOBKL3 (N-6His)

Contact us
Catalog number: C286
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: Recombinant Human MOB-Like Protein Phocein, MOB4, MOBKL3 (N-6His)
Quantity: 100ul
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human MOB-Like Protein Phocein is produced by our E, coli expression system and the target gene encoding Met1-Ala225 is expressed with a 6His tag at the N-terminus
Molecular Weight: 2 kD, 28
UniProt number: Q9Y3A3
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM DTT, 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MOB4, MOBKL3 (N-6His), MOB-Like Protein Phocein
Short name: MOB4, MOBKL3 (N-6His), Recombinant MOB-Like Protein Phocein
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: MOB4, MOBKL3 (N-6His), sapiens MOB-Like Protein Phocein, recombinant H
Alternative technique: rec
Identity: 17261
Gene: MOB4 | More about : MOB4
Long gene name: MOB family member 4, phocein
Synonyms gene: PREI3 MOBKL3
Synonyms gene name: Mps One Binder kinase activator-like 3 (yeast) , preimplantation protein 3 MOB1
Synonyms: MOB3 DKFZP564M112 CGI-95 2C4D PHOCN
Synonyms name: Mob-like protein , phocein phocein
Locus: 2q33, 1
Discovery year: 2002-01-16
GenBank acession: AF151853
Entrez gene record: 25843
Pubmed identfication: 17853115 10810093 11230166 11319234
RefSeq identity: NM_015387
Classification: STRIPAK complex MOB kinase activators
Havana BLAST/BLAT: OTTHUMG00000132748

Related Products :

C286 Recombinant Human MOB-Like Protein Phocein, MOB4, MOBKL3 (N-6His) 10 µg 202 € novo human
GENTAUR-58bd60b8b89a2 Human MOB-like protein phocein (MOB4) 100ug 1680 € MBS Recombinant Proteins human
GENTAUR-58bd60b915e54 Human MOB-like protein phocein (MOB4) 1000ug 1680 € MBS Recombinant Proteins human
GENTAUR-58bd60b9618d5 Human MOB-like protein phocein (MOB4) 100ug 2194 € MBS Recombinant Proteins human
GENTAUR-58bd60b9aae76 Human MOB-like protein phocein (MOB4) 1000ug 2194 € MBS Recombinant Proteins human
GENTAUR-58bdb48236e17 Chicken MOB-like protein phocein (MOB4) 100ug 1674 € MBS Recombinant Proteins chicken
GENTAUR-58bdb482cc6a4 Chicken MOB-like protein phocein (MOB4) 1000ug 1674 € MBS Recombinant Proteins chicken
GENTAUR-58bdb4832c8c6 Chicken MOB-like protein phocein (MOB4) 100ug 2188 € MBS Recombinant Proteins chicken
GENTAUR-58bdb4836d3a5 Chicken MOB-like protein phocein (MOB4) 1000ug 2188 € MBS Recombinant Proteins chicken
C297 Recombinant Human MOB Kinase Activator 1A, MOB1A (C-6His) 500 µg 1613 € novo human
GWB-P1205I MOBKL3, 1-225aa, Recombinant Protein bulk Ask price € genways bulk human
GENTAUR-58bd88a609df6 Dictyostelium discoideum MOB kinase activator-like 2 (mob2) 100ug 1658 € MBS Recombinant Proteins human
GENTAUR-58bd88a67f128 Dictyostelium discoideum MOB kinase activator-like 2 (mob2) 1000ug 1658 € MBS Recombinant Proteins human
GENTAUR-58bd88a6d6f3e Dictyostelium discoideum MOB kinase activator-like 2 (mob2) 100ug 2172 € MBS Recombinant Proteins human
GENTAUR-58bd88a76614d Dictyostelium discoideum MOB kinase activator-like 2 (mob2) 1000ug 2172 € MBS Recombinant Proteins human
GWB-BSP535 MOBKL3 Human Protein bulk Ask price € genways bulk human
abx903299 Anti-MOB4 siRNA 30 nmol 717 € abbex human
abx924368 Anti-MOB4 siRNA 30 nmol 717 € abbex human
abx924369 Anti-MOB4 siRNA 15 nmol 528 € abbex human
AR09773PU-L anti-MOBKL3 (1-225, His-tag) Antibody 0,25 mg 1500 € acr human
AR09773PU-N anti-MOBKL3 (1-225, His-tag) Antibody 50 Вµg 587 € acr human
C11946-1 anti-MOBKL3 Antibody 50 Вµg 347 € acr human
C11946-2 anti-MOBKL3 Antibody 0,1 mg 500 € acr human
GENTAUR-58be3e087c649 Anti- MOBKL3 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be451ba4f89 Anti- MOBKL3 Antibody 100ug 370 € MBS Polyclonals human
MBS422547 Goat anti-MOBKL3 (aa137-151) Antibody 100ug 370 € MBS Polyclonals_1 human
R34918-100UG MOBKL3 Antibody 0.1mg 406 € NJS poly human
GWB-4C0BDB MOBKL3 Over-expression Lysate reagent 1 x 1 vial 562 € genways human
GENTAUR-58be5c5a374dd Anti-PREI3/Phocein (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-12275R-A350 PREI3/Phocein Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human