| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Z-DNA Binding Protein 1 is produced by our E, coli expression system and the target gene encoding Met1-Ser149 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
17, 5 kD |
| UniProt number: |
Q9H171 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAKRPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ZBP1 (C-6His), Z-DNA Binding Protein 1 |
| Short name: |
ZBP1 (C-6His), Recombinant Z-DNA Binding Protein 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Z-Desoxyribonucleic acid binding protein 1 (C-6His), sapiens Z-Desoxyribonucleic acid Binding Protein 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ZBP1 and IDBG-641257 and ENSBTAG00000012406 and 508333, ZBP1 and IDBG-82385 and ENSG00000124256 and 81030, Zbp1 and IDBG-213369 and ENSMUSG00000027514 and 58203, nuclei, protein binding, this GO :0003677 and DNA binding and molecular function this GO :0003692 and left-handed Z-DNA binding and molecular function this GO :0003723 and RNA binding and molecular function this GO :0003726 and double-stranded RNA adenosine deaminase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0008150 and biological process and biological process this GO :0008152 and metabolic process and biological process this GO :0032481 and positive regulation of type I interferon production and biological process this GO :0045087 and innate immune response and biological process this GO :0060340 and positive regulation of type I interferon-mediated signaling pathway and biological process, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003692 : left-handed Z-DNA binding and also this GO :0003723 : RNA binding and also this GO :0003726 : double-stranded RNA adenosine deaminase activity and also this GO :0005515 : protein binding, this GO :0003692 : left-handed Z-DNA binding, this GO :0003723 : RNA binding, this GO :0003726 : double-stranded RNA adenosine deaminase activity, this GO :0005515 : protein binding, Z-DNA binding protein 1 |
| Identity: |
16176 |
| Gene: |
ZBP1 |
More about : ZBP1 |
| Long gene name: |
Z-DNA binding protein 1 |
| Synonyms gene: |
C20orf183 |
| Synonyms gene name: |
chromosome 20 open reading frame 183 |
| Synonyms: |
dJ718J7, 3 DLM1 DLM-1 DAI |
| Synonyms name: |
DNA-dependent activator of IRFs |
| Locus: |
20q13, 31 |
| Discovery year: |
2001-07-17 |
| GenBank acession: |
AJ300575 |
| Entrez gene record: |
81030 |
| Pubmed identfication: |
11842111 |
| RefSeq identity: |
NM_030776 |
| Havana BLAST/BLAT: |
OTTHUMG00000032824 |