Recombinant Human Galactose Mutarotase, GALM (C-6His)

Catalog number:	C278 Buy Now
Price:	1995 €
Supplier:	MBS Recombinant Proteins
Product name:	Recombinant Human Galactose Mutarotase, GALM (C-6His)
Quantity:	1000ug
Other quantities:	1 mg 2283€ 10 µg 202€
Related search:	human mutarotase galm sapiens chis aldose expression

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Galactose Mutarotase is produced by our E, coli expression system and the target gene encoding Ala2-Ala342 is expressed with a 6His tag at the C-terminus
Molecular Weight:	38, 8 kD
UniProt number:	Q96C23
State of the product:	Liquid
Shipping conditions:	Dry ice/ice packs
Formulation:	150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	ASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVALEHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	GALM (C-6His), Galactose Mutarotase
Short name:	GALM (C-6His), Recombinant Galactose Mutarotase
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	GALM (C-6His), sapiens Galactose Mutarotase, recombinant H
Alternative technique:	rec
Identity:	24063
Gene:	GALM | More about : GALM
Long gene name:	galactose mutarotase
Synonyms name:	aldose 1-epimerase aldose mutarotase galactomutarotase
Locus:	2p22, 1
Discovery year:	2004-01-13
Entrez gene record:	130589
Pubmed identfication:	12753898
RefSeq identity:	NM_138801
Havana BLAST/BLAT:	OTTHUMG00000102077

• #human
• #mutarotase
• #galm
• #sapiens
• #chis
• #aldose
• #expression