| Catalog number: | C278 |
|---|---|
| Price: | 1995 € |
| Supplier: | MBS Recombinant Proteins |
| Product name: | Recombinant Human Galactose Mutarotase, GALM (C-6His) |
| Quantity: | 1000ug |
| Other quantities: | 1 mg 2283€ 10 µg 202€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Galactose Mutarotase is produced by our E, coli expression system and the target gene encoding Ala2-Ala342 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 38, 8 kD |
| UniProt number: | Q96C23 |
| State of the product: | Liquid |
| Shipping conditions: | Dry ice/ice packs |
| Formulation: | 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0 |
| Storage recommendations: | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | ASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVALEHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | GALM (C-6His), Galactose Mutarotase |
| Short name: | GALM (C-6His), Recombinant Galactose Mutarotase |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | GALM (C-6His), sapiens Galactose Mutarotase, recombinant H |
| Alternative technique: | rec |
| Identity: | 24063 |
| Gene: | GALM | More about : GALM |
| Long gene name: | galactose mutarotase |
| Synonyms name: | aldose 1-epimerase aldose mutarotase galactomutarotase |
| Locus: | 2p22, 1 |
| Discovery year: | 2004-01-13 |
| Entrez gene record: | 130589 |
| Pubmed identfication: | 12753898 |
| RefSeq identity: | NM_138801 |
| Havana BLAST/BLAT: | OTTHUMG00000102077 |
| C278 | Recombinant Human Galactose Mutarotase, GALM (C-6His) | 500 µg | 1613 € | novo | human |
| GENTAUR-58be5d66a9d06 | Anti-GALM/Galactose mutarotase, ALEXA Fluor 594 | 100 microliters | 489 € | Bioss Polyclonal Antibodies | human |
| bs-13268R-A350 | GALM/Galactose mutarotase Antibody, ALEXA FLUOR 350 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-13268R-A488 | GALM/Galactose mutarotase Antibody, ALEXA FLUOR 488 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-13268R-A555 | GALM/Galactose mutarotase Antibody, ALEXA FLUOR 555 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-13268R-A594 | GALM/Galactose mutarotase Antibody, ALEXA FLUOR 594 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-13268R-A647 | GALM/Galactose mutarotase Antibody, ALEXA FLUOR 647 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-13268R-Biotin | GALM/Galactose mutarotase Antibody, Biotin Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |
| bs-13268R | GALM/Galactose mutarotase Antibody | 0.1ml | 263 € | Bioss Primary Unconjugated Antibodies | human |
| bs-13268R-Cy3 | GALM/Galactose mutarotase Antibody, Cy3 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-13268R-Cy5 | GALM/Galactose mutarotase Antibody, Cy5 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-13268R-Cy5.5 | GALM/Galactose mutarotase Antibody, Cy5.5 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-13268R-Cy7 | GALM/Galactose mutarotase Antibody, Cy7 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-13268R-FITC | GALM/Galactose mutarotase Antibody, FITC Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |
| bs-13268R-HRP | GALM/Galactose mutarotase Antibody, HRP Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| MBS617393 | MGL1, MGL2 (Macrophage Galactose N-acetyl-galactosamine Specific Lectin 1, Macrophage Galactose N-acetyl-galactosamine Specific Lectin 2) | 100ug | 774 € | MBS Polyclonals_1 | human |
| GWB-P1418A | GALM, 1-342aa, Recombinant Protein | bulk | Ask price € | genways bulk | human |
| GWB-BSP184 | GALM Human Protein | bulk | Ask price € | genways bulk | human |
| LV165932 | GALM Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV165933 | GALM Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV165934 | GALM Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV165935 | GALM Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV165937 | GALM Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV165936 | GALM Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| GENTAUR-58ba8bfeaf144 | Aldose 1-epimerase (galM) | 100ug | 1989 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba8bff0c026 | Aldose 1-epimerase (galM) | 1000ug | 1989 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba8bff537bf | Aldose 1-epimerase (galM) | 100ug | 2503 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba8bffa5c2c | Aldose 1-epimerase (galM) | 1000ug | 2503 € | MBS Recombinant Proteins | human |
| GENTAUR-58bb5854a97df | Aldose 1-epimerase (galM) | 100ug | 1995 € | MBS Recombinant Proteins | human |
| GENTAUR-58bb5854f04e5 | Aldose 1-epimerase (galM) | 1000ug | 1995 € | MBS Recombinant Proteins | human |