Recombinant Human Galactose Mutarotase, GALM (C-6His)

Contact us
Catalog number: C278
Price: 1995 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Galactose Mutarotase, GALM (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Galactose Mutarotase is produced by our E, coli expression system and the target gene encoding Ala2-Ala342 is expressed with a 6His tag at the C-terminus
Molecular Weight: 38, 8 kD
UniProt number: Q96C23
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVALEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GALM (C-6His), Galactose Mutarotase
Short name: GALM (C-6His), Recombinant Galactose Mutarotase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: GALM (C-6His), sapiens Galactose Mutarotase, recombinant H
Alternative technique: rec
Identity: 24063
Gene: GALM | More about : GALM
Long gene name: galactose mutarotase
Synonyms name: aldose 1-epimerase aldose mutarotase galactomutarotase
Locus: 2p22, 1
Discovery year: 2004-01-13
Entrez gene record: 130589
Pubmed identfication: 12753898
RefSeq identity: NM_138801
Havana BLAST/BLAT: OTTHUMG00000102077

Related Products :

C278 Recombinant Human Galactose Mutarotase, GALM (C-6His) 500 µg 1613 € novo human
GENTAUR-58be5d66a9d06 Anti-GALM/Galactose mutarotase, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-13268R-A350 GALM/Galactose mutarotase Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13268R-A488 GALM/Galactose mutarotase Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13268R-A555 GALM/Galactose mutarotase Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13268R-A594 GALM/Galactose mutarotase Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13268R-A647 GALM/Galactose mutarotase Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13268R-Biotin GALM/Galactose mutarotase Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-13268R GALM/Galactose mutarotase Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-13268R-Cy3 GALM/Galactose mutarotase Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13268R-Cy5 GALM/Galactose mutarotase Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13268R-Cy5.5 GALM/Galactose mutarotase Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13268R-Cy7 GALM/Galactose mutarotase Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13268R-FITC GALM/Galactose mutarotase Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-13268R-HRP GALM/Galactose mutarotase Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
MBS617393 MGL1, MGL2 (Macrophage Galactose N-acetyl-galactosamine Specific Lectin 1, Macrophage Galactose N-acetyl-galactosamine Specific Lectin 2) 100ug 774 € MBS Polyclonals_1 human
GWB-P1418A GALM, 1-342aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP184 GALM Human Protein bulk Ask price € genways bulk human
LV165932 GALM Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV165933 GALM Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV165934 GALM Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV165935 GALM Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV165937 GALM Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV165936 GALM Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58ba8bfeaf144 Aldose 1-epimerase (galM) 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58ba8bff0c026 Aldose 1-epimerase (galM) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58ba8bff537bf Aldose 1-epimerase (galM) 100ug 2503 € MBS Recombinant Proteins human
GENTAUR-58ba8bffa5c2c Aldose 1-epimerase (galM) 1000ug 2503 € MBS Recombinant Proteins human
GENTAUR-58bb5854a97df Aldose 1-epimerase (galM) 100ug 1995 € MBS Recombinant Proteins human
GENTAUR-58bb5854f04e5 Aldose 1-epimerase (galM) 1000ug 1995 € MBS Recombinant Proteins human