Recombinant Human Uroporphyrinogen Decarboxylase, UROD (N-6His)

Catalog number:	C273 Buy Now
Price:	50 €
Supplier:	abbex
Product name:	Recombinant Human Uroporphyrinogen Decarboxylase, UROD (N-6His)
Quantity:	inquire
Other quantities:	1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:	human urod sapiens nhis locus produced

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Uroporphyrinogen Decarboxylase is produced by our E, coli expression system and the target gene encoding Met1-Asn367 is expressed with a 6His tag at the N-terminus
Molecular Weight:	43 kD
UniProt number:	P06132
State of the product:	Liquid
Shipping conditions:	Dry ice/ice packs
Formulation:	1 mM DTT, 1 mM EDTA, 100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MGSSHHHHHHSSGLVPRGSHMEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQVNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	UROD (N-6His), Uroporphyrinogen Decarboxylase
Short name:	UROD (N-6His), Recombinant Uroporphyrinogen Decarboxylase
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	UROD (N-6His), sapiens Uroporphyrinogen Decarboxylase, recombinant H
Alternative technique:	rec
Identity:	12591
Gene:	UROD | More about : UROD
Long gene name:	uroporphyrinogen decarboxylase
Locus:	1p34, 1
Discovery year:	2001-06-22
GenBank acession:	BC001778
Entrez gene record:	7389
Pubmed identfication:	3015909 3460962
RefSeq identity:	NM_000374
Havana BLAST/BLAT:	OTTHUMG00000008949
Locus Specific Databases:	LRG_1079

• #human
• #urod
• #sapiens
• #nhis
• #locus
• #produced