Recombinant Human Uroporphyrinogen Decarboxylase, UROD (N-6His)

Contact us
Catalog number: C273
Price: 50 €
Supplier: abbex
Product name: Recombinant Human Uroporphyrinogen Decarboxylase, UROD (N-6His)
Quantity: inquire
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Uroporphyrinogen Decarboxylase is produced by our E, coli expression system and the target gene encoding Met1-Asn367 is expressed with a 6His tag at the N-terminus
Molecular Weight: 43 kD
UniProt number: P06132
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM DTT, 1 mM EDTA, 100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQVNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: UROD (N-6His), Uroporphyrinogen Decarboxylase
Short name: UROD (N-6His), Recombinant Uroporphyrinogen Decarboxylase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: UROD (N-6His), sapiens Uroporphyrinogen Decarboxylase, recombinant H
Alternative technique: rec
Identity: 12591
Gene: UROD | More about : UROD
Long gene name: uroporphyrinogen decarboxylase
Locus: 1p34, 1
Discovery year: 2001-06-22
GenBank acession: BC001778
Entrez gene record: 7389
Pubmed identfication: 3015909 3460962
RefSeq identity: NM_000374
Havana BLAST/BLAT: OTTHUMG00000008949
Locus Specific Databases: LRG_1079

Related Products :

C273 Recombinant Human Uroporphyrinogen Decarboxylase, UROD (N-6His) 500 µg 1613 € novo human
AE12078MO-48 ELISA test for Mouse Uroporphyrinogen decarboxylase (UROD) 1x plate of 48 wells 373 € abebio mouse
AE12077RA-48 ELISA test for Rat Uroporphyrinogen decarboxylase (UROD) 1x plate of 48 wells 373 € abebio rat
AE12076SH-48 ELISA test for Sheep Uroporphyrinogen decarboxylase (UROD) 1x plate of 48 wells 402 € abebio sheep
AE12078MO Mouse Uroporphyrinogen decarboxylase (UROD) ELISA Kit 96 wells plate 769 € ab-elisa elisas mouse
AE12078MO-96 Mouse Uroporphyrinogen decarboxylase (UROD) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
AE12077RA Rat Uroporphyrinogen decarboxylase (UROD) ELISA Kit 96 wells plate 769 € ab-elisa elisas rat
AE12077RA-96 Rat Uroporphyrinogen decarboxylase (UROD) ELISA Kit 1x plate of 96 wells 612 € abebio rat
DL-UROD-Ra Rat Uroporphyrinogen Decarboxylase UROD ELISA Kit 96T 962 € DL elisas rat
AE12076SH Sheep Uroporphyrinogen decarboxylase (UROD) ELISA Kit 96 wells plate 810 € ab-elisa elisas sheep
AE12076SH-96 Sheep Uroporphyrinogen decarboxylase (UROD) ELISA Kit 1x plate of 96 wells 671 € abebio sheep
EKU08060 Uroporphyrinogen Decarboxylase (UROD) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
GWB-P1426I UROD, 1-367aa, Recombinant Protein bulk Ask price € genways bulk human
C268 Recombinant Human Uroporphyrinogen-III Synthase, UROIIIS (C-6His) 50 µg 496 € novo human
MBS248386 Goat Polyclonal to Human UROD Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-BSP341 UROD Human Protein bulk Ask price € genways bulk human
LV353111 UROD Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
abx156211 Anti-Rat UROD ELISA Kit inquire 50 € abbex rat
AR09549PU-L anti-UROD (1-367, His-tag) Antibody 0,5 mg 1022 € acr human
AR09549PU-N anti-UROD (1-367, His-tag) Antibody 0,1 mg 413 € acr human
AP32135PU-N anti-UROD Antibody 0,1 mg 558 € acr human
GENTAUR-58be119908f56 Anti- UROD Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be11995e383 Anti- UROD Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be41640bae7 Anti- UROD Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be41e9c4396 Anti- UROD Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58be530047dd6 Anti- UROD Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be530098088 Anti- UROD Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be5301093f4 Anti- UROD Antibody 100ug 387 € MBS Polyclonals human
abx141761 Anti-UROD Antibody 50 μl 311 € abbex human
abx217663 Anti-UROD Antibody inquire 50 € abbex human