Recombinant Human Prefoldin Subunit 2, PFDN2 (N-6His)

Contact us
Catalog number: C254
Price: 6662 €
Supplier: abbex
Product name: Recombinant Human Prefoldin Subunit 2, PFDN2 (N-6His)
Quantity: 1 mg
Other quantities: 1 mg 2283€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Prefoldin Subunit 2 is produced by our E, coli expression system and the target gene encoding Met1-Ser154 is expressed with a 6His tag at the N-terminus
Molecular Weight: 18, 8 kD
UniProt number: Q9UHV9
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM DTT, 50 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PFDN2 (N-6His), Prefoldin Subunit 2
Short name: PFDN2 (N-6His), Recombinant Prefoldin Subunit 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PFDN2 (N-6His), sapiens Prefoldin functionnal sequence 2, recombinant H
Alternative technique: rec
Identity: 8867
Gene: PFDN2 | More about : PFDN2
Long gene name: prefoldin subunit 2
Synonyms gene name: prefoldin 2
Locus: 1q23, 3
Discovery year: 1998-08-06
GenBank acession: AF165883
Entrez gene record: 5202
Pubmed identfication: 10051400
RefSeq identity: NM_012394
Classification: Prefoldin subunits
Havana BLAST/BLAT: OTTHUMG00000031481

Related Products :

C254 Recombinant Human Prefoldin Subunit 2, PFDN2 (N-6His) 500 µg 1613 € novo human
AE27923HU-48 ELISA test for Human Prefoldin subunit 2 (PFDN2) 1x plate of 48 wells 373 € abebio human
GENTAUR-58bd876056195 Human Prefoldin subunit 2 (PFDN2) 100ug 1509 € MBS Recombinant Proteins human
GENTAUR-58bd8760c7132 Human Prefoldin subunit 2 (PFDN2) 1000ug 1509 € MBS Recombinant Proteins human
GENTAUR-58bd876135184 Human Prefoldin subunit 2 (PFDN2) 100ug 2011 € MBS Recombinant Proteins human
GENTAUR-58bd87618db7e Human Prefoldin subunit 2 (PFDN2) 1000ug 2011 € MBS Recombinant Proteins human
AE27923HU-96 Human Prefoldin subunit 2 (PFDN2) ELISA Kit 1x plate of 96 wells 612 € abebio human
GENTAUR-58bda841c3d79 Dictyostelium discoideum Probable prefoldin subunit 2 (pfdn2) 100ug 1409 € MBS Recombinant Proteins human
GENTAUR-58bda8422950d Dictyostelium discoideum Probable prefoldin subunit 2 (pfdn2) 1000ug 1409 € MBS Recombinant Proteins human
GENTAUR-58bda8429a9e0 Dictyostelium discoideum Probable prefoldin subunit 2 (pfdn2) 100ug 1912 € MBS Recombinant Proteins human
GENTAUR-58bda842f2976 Dictyostelium discoideum Probable prefoldin subunit 2 (pfdn2) 1000ug 1912 € MBS Recombinant Proteins human
GENTAUR-58b884b197a58 Mouse Prefoldin subunit 2 (Pfdn2) 100ug 1509 € MBS Recombinant Proteins mouse
GENTAUR-58b884b1ef36a Mouse Prefoldin subunit 2 (Pfdn2) 1000ug 1509 € MBS Recombinant Proteins mouse
GENTAUR-58b884b26703c Mouse Prefoldin subunit 2 (Pfdn2) 100ug 2011 € MBS Recombinant Proteins mouse
GENTAUR-58b884b2b8b09 Mouse Prefoldin subunit 2 (Pfdn2) 1000ug 2011 € MBS Recombinant Proteins mouse
CE13 Recombinant Human Prefoldin Subunit 4, PFDN4 (N-6His) 50 µg 496 € novo human
RP-1203H Recombinant Human PFD2 / PFDN2 Protein (His Tag) 20μg 572 € adv human
GWB-P1264C PFDN2, 1-154aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP573 PFDN2 Human Protein bulk Ask price € genways bulk human
LV260329 PFDN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
AR09713PU-L anti-PFDN2 (1-154, His-tag) Antibody 0,25 mg 1138 € acr human
AR09713PU-N anti-PFDN2 (1-154, His-tag) Antibody 50 Вµg 485 € acr human
abx903954 Anti-PFDN2 siRNA 15 nmol 528 € abbex human
abx928306 Anti-PFDN2 siRNA 30 nmol 717 € abbex human
abx928307 Anti-PFDN2 siRNA 15 nmol 528 € abbex human
GWB-MU489C PFDN2 antibody 1 vial 521 € genways human
GWB-21D2EA PFDN2 Over-expression Lysate reagent 1 x 1 vial 463 € genways human
abx166742 Anti-Prefoldin Subunit 1 Protein (Recombinant) 50 μg 601 € abbex human
abx263213 Anti-Prefoldin Subunit 1 Protein (Recombinant) 5 µg 340 € abbex human
abx262447 Anti-Prefoldin Subunit 2 Protein (Recombinant) 1 mg 6662 € abbex human