Recombinant Human Prefoldin Subunit 4, PFDN4 (N-6His)

Contact us
Catalog number: CE13
Price: 1420 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Prefoldin Subunit 4, PFDN4 (N-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Prefoldin Subunit 4 is produced by our E, coli expression system and the target gene encoding Met1-Ser134 is expressed with a 6His tag at the N-terminus
Molecular Weight: 17, 48 kD
UniProt number: Q9NQP4
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PFDN4 (N-6His), Prefoldin Subunit 4
Short name: PFDN4 (N-6His), Recombinant Prefoldin Subunit 4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PFDN4 (N-6His), sapiens Prefoldin functionnal sequence 4, recombinant H
Alternative technique: rec
Identity: 8868
Gene: PFDN4 | More about : PFDN4
Long gene name: prefoldin subunit 4
Synonyms gene name: prefoldin 4
Synonyms: PFD4 C-1 C1
Locus: 20q13, 2
Discovery year: 1998-08-06
GenBank acession: U41816
Entrez gene record: 5203
Pubmed identfication: 9630229 8744932
RefSeq identity: NM_002623
Classification: Prefoldin subunits
Havana BLAST/BLAT: OTTHUMG00000032775

Related Products :

CE13 Recombinant Human Prefoldin Subunit 4, PFDN4 (N-6His) 50 µg 496 € novo human
AE27919HU-48 ELISA test for Human Prefoldin subunit 4 (PFDN4) 1x plate of 48 wells 373 € abebio human
AE27919HU-96 Human Prefoldin subunit 4 (PFDN4) ELISA Kit 1x plate of 96 wells 612 € abebio human
RP-1205H Recombinant Human PFDN4 / PFD4 Protein (His Tag) 20μg 572 € adv human
GWB-P1145A PFDN4, 1-134aa, Recombinant Protein bulk Ask price € genways bulk human
C254 Recombinant Human Prefoldin Subunit 2, PFDN2 (N-6His) 500 µg 1613 € novo human
GWB-BSP574 PFDN4 Human Protein bulk Ask price € genways bulk human
LV792342 PFDN4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
AR09833PU-L anti-PFDN4 (1-134, His-tag) Antibody 0,25 mg 1500 € acr human
AR09833PU-N anti-PFDN4 (1-134, His-tag) Antibody 50 Вµg 587 € acr human
GENTAUR-58be3c8804ed6 Anti- PFDN4 Antibody 100ug 393 € MBS Polyclonals human
abx928308 Anti-PFDN4 siRNA inquire 50 € abbex human
GWB-MW561C PFDN4 antibody 1 vial 521 € genways human
GWB-F83771 PFDN4 Over-expression Lysate reagent 1 vial 463 € genways human
MBS129860 PFDN4 Polyclonal Antibody 200ug 663 € MBS Polyclonals_1 human
abx166742 Anti-Prefoldin Subunit 1 Protein (Recombinant) 50 μg 601 € abbex human
abx263213 Anti-Prefoldin Subunit 1 Protein (Recombinant) 5 µg 340 € abbex human
abx262447 Anti-Prefoldin Subunit 2 Protein (Recombinant) 1 mg 6662 € abbex human
abx262474 Anti-Prefoldin Subunit 4 Protein (Recombinant) 1 mg 6662 € abbex human
abx261475 Anti-Prefoldin Subunit 5 Protein (Recombinant) 5 µg 238 € abbex human
abx262721 Anti-Prefoldin Subunit 6 Protein (Recombinant) 10 µg 340 € abbex human
abx152817 Anti-Human Prefoldin Subunit 1 ELISA Kit 96 tests 934 € abbex human
abx572530 Anti-Human Prefoldin Subunit 1 (PFDN1) ELISA Kit inquire 50 € abbex human
abx156907 Anti-Human Prefoldin Subunit 5 ELISA Kit inquire 50 € abbex human
AE27926HU-48 ELISA test for Human Prefoldin subunit 1 (PFDN1) 1x plate of 48 wells 373 € abebio human
AE27923HU-48 ELISA test for Human Prefoldin subunit 2 (PFDN2) 1x plate of 48 wells 373 € abebio human
AE11789HU-48 ELISA test for Human Prefoldin subunit 3 (VBP1) 1x plate of 48 wells 373 € abebio human
AE27916HU-48 ELISA test for Human Prefoldin subunit 5 (PFDN5) 1x plate of 48 wells 373 € abebio human
AE27913HU-48 ELISA test for Human Prefoldin subunit 6 (PFDN6) 1x plate of 48 wells 373 € abebio human
GENTAUR-58b88a9804cf5 Human Prefoldin subunit 1 (PFDN1) 100ug 1420 € MBS Recombinant Proteins human