Recombinant Human Prefoldin Subunit 2, PFDN2 (N-6His)

Catalog number:	C254 Buy Now
Price:	6662 €
Supplier:	abbex
Product name:	Recombinant Human Prefoldin Subunit 2, PFDN2 (N-6His)
Quantity:	1 mg
Other quantities:	1 mg 2283€ 10 µg 202€
Related search:	human prefoldin gene pfdn sapiens nhis nbsp

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Prefoldin Subunit 2 is produced by our E, coli expression system and the target gene encoding Met1-Ser154 is expressed with a 6His tag at the N-terminus
Molecular Weight:	18, 8 kD
UniProt number:	Q9UHV9
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	1 mM DTT, 50 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MGSSHHHHHHSSGLVPRGSHMAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	PFDN2 (N-6His), Prefoldin Subunit 2
Short name:	PFDN2 (N-6His), Recombinant Prefoldin Subunit 2
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	PFDN2 (N-6His), sapiens Prefoldin functionnal sequence 2, recombinant H
Alternative technique:	rec
Identity:	8867
Gene:	PFDN2 | More about : PFDN2
Long gene name:	prefoldin subunit 2
Synonyms gene name:	prefoldin 2
Locus:	1q23, 3
Discovery year:	1998-08-06
GenBank acession:	AF165883
Entrez gene record:	5202
Pubmed identfication:	10051400
RefSeq identity:	NM_012394
Classification:	Prefoldin subunits
Havana BLAST/BLAT:	OTTHUMG00000031481

• #human
• #prefoldin
• #gene
• #pfdn
• #sapiens
• #nhis
• #nbsp