Recombinant Human Cyclophilin E, PPIase E, PPIE (N-6His)

Contact us
Catalog number: C216
Price: 558 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Cyclophilin E, PPIase E, PPIE (N-6His)
Quantity: 0.2 mg
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cyclophilin E is produced by our E, coli expression system and the target gene encoding Met1-Val301 is expressed with a 6His tag at the N-terminus
Molecular Weight: 35, 6 kD
UniProt number: Q9UNP9
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PPIE (N-6His), PPIase E, Cyclophilin E
Short name: PPIE (N-6His), PPIase E, Recombinant Cyclophilin E
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PPIase E, peptidylprolyl isomerase E (cyclophilin E) (N-6His), sapiens Cyclophilin E, recombinant H
Alternative technique: rec
Alternative to gene target: BT, CYP-33 and CYP33, DNA-templated and biological process this GO :0006457 and protein folding and biological process this GO :0016018 and cyclosporin A binding and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045070 and positive regulation of viral genome replication and biological process this GO :0071013 and catalytic step 2 spliceosome and cellular component, PPIE and IDBG-96746 and ENSG00000084072 and 10450, Ppie and IDBG-184920 and ENSMUSG00000028651 and 56031, nuclei, poly(A) RNA binding, this GO :0000166 and nucleotide binding and molecular function this GO :0000398 and mRNA splicing, this GO :0000166 : nucleotide binding, this GO :0000166 : nucleotide binding and also this GO :0003676 : nucleic acid binding and also this GO :0003723 : RNA binding and also this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity and also this GO :0005515 : protein binding and also this GO :0016018 : cyclosporin A binding and also this GO :0044822 : poly(A) RNA binding, this GO :0003676 : nucleic acid binding, this GO :0003723 : RNA binding, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity, this GO :0005515 : protein binding, this GO :0016018 : cyclosporin A binding, this GO :0044822 : poly(A) RNA binding, via spliceosome and biological process this GO :0000413 and protein peptidyl-prolyl isomerization and biological process this GO :0003676 and nucleic acid binding and molecular function this GO :0003723 and RNA binding and molecular function this GO :0003755 and peptidyl-prolyl cis-trans isomerase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0006355 and regulation of transcription, 21742 and IDBG-640866 and ENSBTAG00000047314 and 100296550, 787681, peptidylprolyl isomerase E (cyclophilin E)
Identity: 9258
Gene: PPIE | More about : PPIE
Long gene name: peptidylprolyl isomerase E
Synonyms: CyP-33 MGC3736 MGC111222
Synonyms name: isoform 1 , peptidyl-prolyl cis-trans isomerase E cyclophilin 33 cyclophilin E PPIase E rotamase E peptidylprolyl isomerase E
Locus: 1p34, 2
Discovery year: 1999-07-07
GenBank acession: AF042385
Entrez gene record: 10450
Pubmed identfication: 9747881
RefSeq identity: NM_006112
Classification: RNA binding motif containing Cyclophilin peptidylprolyl isomerases
Havana BLAST/BLAT: OTTHUMG00000009248
Locus Specific Databases: LRG_1053

Related Products :

C216 Recombinant Human Cyclophilin E, PPIase E, PPIE (N-6His) 10 µg 202 € novo human
C215 Recombinant Human Cyclophilin C, PPIase C, PPIC (N-Trx, 6His) 10 µg 202 € novo human
GWB-P0084F PPIE (Cyclophilin E), 1-301aa, Recombinant Protein bulk Ask price € genways bulk human
CE96 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase D, PPID, PPIase D (N, C-6His) 500 µg 1613 € novo human
C291 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase-Like 1, PPIase, PPIL1(N-6His) 500 µg 1613 € novo human
RP-1242H Recombinant Human PPIase / FKBP7 Protein (Fc Tag) 20μg 572 € adv human
RP-1241H Recombinant Human PPIase / FKBP7 Protein (His Tag) 20μg 572 € adv human
AP55142SU-N anti-Peptidyl-prolyl cis-trans isomerase A (PPIA/PPIase 1) Antibody 0,2 ml 630 € acr human
GENTAUR-58be20a8508b5 Anti-PPIase Antibody 100ul 542 € MBS mono human
MBS624484 FKBP14, NT (FK506-binding Protein 14, Peptidyl-prolyl Cis-trans Isomerase FKBP14, PPIase FKBP14, Rotamase, 22kD FK506-binding Protein, 22kD FKBP, FKBP-2, FKBP-22, FKBP22, FKBP-14, UNQ322/PRO381) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS619128 FKBP4 (FK506 Binding Protein 4, 59kD, FK506 binding protein 4, FKBP52, FKBP59, HBI, Hsp56, PPIase, p52, HSP binding immunophilin, T-cell FK506-binding protein, peptidylprolyl cis-trans isomerase, rotamase) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS623609 FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52) Antibody 200ul 603 € MBS Polyclonals_1 human
GENTAUR-58be4c14bb413 PPIase Antibody 100ug 442 € MBS mono human
GENTAUR-58be4c56e6279 PPIase Antibody 100ug 442 € MBS mono human
GENTAUR-58bdad18ee3ba Rickettsia bellii Parvulin-like PPIase (plp) 100ug 1779 € MBS Recombinant Proteins human
GENTAUR-58bdad19674b3 Rickettsia bellii Parvulin-like PPIase (plp) 1000ug 1779 € MBS Recombinant Proteins human
GENTAUR-58bdad19b10ac Rickettsia bellii Parvulin-like PPIase (plp) 100ug 2293 € MBS Recombinant Proteins human
GENTAUR-58bdad1a0b45c Rickettsia bellii Parvulin-like PPIase (plp) 1000ug 2293 € MBS Recombinant Proteins human
LV269359 PPIE Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdd4be0979f Anti- Peptidylprolyl Isomerase E (PPIE) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd663ed78a Anti- Peptidylprolyl Isomerase E (PPIE) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd8ce1b6f8 Anti- Peptidylprolyl Isomerase E (PPIE) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddbf0d1c3e Anti- Peptidylprolyl Isomerase E (PPIE) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bddbf13725a Anti- Peptidylprolyl Isomerase E (PPIE) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bddc2815755 Anti- Peptidylprolyl Isomerase E (PPIE) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bddd7e2e305 Anti- Peptidylprolyl Isomerase E (PPIE) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bddd7eb19a8 Anti- Peptidylprolyl Isomerase E (PPIE) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58be3e88d905a Anti- PPIE Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58be56941dcd2 Anti- PPIE Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be56947cf5d Anti- PPIE Antibody 0.2 mg 558 € MBS Polyclonals human