| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Cyclophilin E is produced by our E, coli expression system and the target gene encoding Met1-Val301 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
35, 6 kD |
| UniProt number: |
Q9UNP9 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
PPIE (N-6His), PPIase E, Cyclophilin E |
| Short name: |
PPIE (N-6His), PPIase E, Recombinant Cyclophilin E |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
PPIase E, peptidylprolyl isomerase E (cyclophilin E) (N-6His), sapiens Cyclophilin E, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, CYP-33 and CYP33, DNA-templated and biological process this GO :0006457 and protein folding and biological process this GO :0016018 and cyclosporin A binding and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045070 and positive regulation of viral genome replication and biological process this GO :0071013 and catalytic step 2 spliceosome and cellular component, PPIE and IDBG-96746 and ENSG00000084072 and 10450, Ppie and IDBG-184920 and ENSMUSG00000028651 and 56031, nuclei, poly(A) RNA binding, this GO :0000166 and nucleotide binding and molecular function this GO :0000398 and mRNA splicing, this GO :0000166 : nucleotide binding, this GO :0000166 : nucleotide binding and also this GO :0003676 : nucleic acid binding and also this GO :0003723 : RNA binding and also this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity and also this GO :0005515 : protein binding and also this GO :0016018 : cyclosporin A binding and also this GO :0044822 : poly(A) RNA binding, this GO :0003676 : nucleic acid binding, this GO :0003723 : RNA binding, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity, this GO :0005515 : protein binding, this GO :0016018 : cyclosporin A binding, this GO :0044822 : poly(A) RNA binding, via spliceosome and biological process this GO :0000413 and protein peptidyl-prolyl isomerization and biological process this GO :0003676 and nucleic acid binding and molecular function this GO :0003723 and RNA binding and molecular function this GO :0003755 and peptidyl-prolyl cis-trans isomerase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0006355 and regulation of transcription, 21742 and IDBG-640866 and ENSBTAG00000047314 and 100296550, 787681, peptidylprolyl isomerase E (cyclophilin E) |
| Identity: |
9258 |
| Gene: |
PPIE |
More about : PPIE |
| Long gene name: |
peptidylprolyl isomerase E |
| Synonyms: |
CyP-33 MGC3736 MGC111222 |
| Synonyms name: |
isoform 1 , peptidyl-prolyl cis-trans isomerase E cyclophilin 33 cyclophilin E PPIase E rotamase E peptidylprolyl isomerase E |
| Locus: |
1p34, 2 |
| Discovery year: |
1999-07-07 |
| GenBank acession: |
AF042385 |
| Entrez gene record: |
10450 |
| Pubmed identfication: |
9747881 |
| RefSeq identity: |
NM_006112 |
| Classification: |
RNA binding motif containing Cyclophilin peptidylprolyl isomerases |
| Havana BLAST/BLAT: |
OTTHUMG00000009248 |
| Locus Specific Databases: |
LRG_1053 |