| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human USP14 is produced by our E, coli expression system and the target gene encoding Asp91-Gln494 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
45 kD, 48 |
| UniProt number: |
P54578 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
100 mM sodium chloride, 20% Glycerol, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
USP14 (N-6His), Ubiquitin Carboxyl-Terminal Hydrolase 14 |
| Short name: |
USP14 (N-6His), Recombinant Ubiquitin Carboxyl-Terminal Hydrolase 14 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
sapiens Ubiquitin Carboxyl-Terminal Hydrolase 14, ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (N-6His), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, Cell surfaces, TGT, USP14 and IDBG-259 and ENSG00000101557 and 9097, Usp14 and IDBG-128322 and ENSMUSG00000047879 and 59025, proteasome binding, this GO :0000502 and proteasome complex and cellular component this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0004221 and ubiquitin thiolesterase activity and molecular function this GO :0004843 and ubiquitin-specific protease activity and molecular function this GO :0004866 and endopeptidase inhibitor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006511 and ubiquitin-dependent protein catabolic process and biological process this GO :0007268 and synaptic transmission and biological process this GO :0008193 and tRNA guanylyltransferase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0009986 and cell surface and cellular component this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0016023 and cytoplasmic membrane-bounded vesicle and cellular component this GO :0016579 and protein deubiquitination and biological process this GO :0036459 and ubiquitinyl hydrolase activity and molecular function this GO :0045202 and synapse and cellular component this GO :0050920 and regulation of chemotaxis and biological process this GO :0061136 and regulation of proteasomal protein catabolic process and biological process this GO :0070628 and proteasome binding and molecular function, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0004221 : ubiquitin thiolesterase activity and also this GO :0004843 : ubiquitin-specific protease activity and also this GO :0004866 : endopeptidase inhibitor activity and also this GO :0005515 : protein binding and also this GO :0008193 : tRNA guanylyltransferase activity and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0036459 : ubiquitinyl hydrolase activity and also this GO :0070628 : proteasome binding, this GO :0004221 : ubiquitin thiolesterase activity, this GO :0004843 : ubiquitin-specific protease activity, this GO :0004866 : endopeptidase inhibitor activity, this GO :0005515 : protein binding, this GO :0008193 : tRNA guanylyltransferase activity, this GO :0008234 : cysteine-type peptidase activity, this GO :0036459 : ubiquitinyl hydrolase activity, this GO :0070628 : proteasome binding, 20599 and IDBG-644085 and ENSBTAG00000019214 and 505106, ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) |
| Identity: |
12612 |
| Gene: |
USP14 |
More about : USP14 |
| Long gene name: |
ubiquitin specific peptidase 14 |
| Synonyms gene name: |
ubiquitin specific protease 14 (tRNA-guanine transglycosylase) ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) |
| Synonyms: |
TGT |
| Locus: |
18p11, 32 |
| Discovery year: |
1999-02-01 |
| GenBank acession: |
U30888 |
| Entrez gene record: |
9097 |
| Pubmed identfication: |
12838346 |
| RefSeq identity: |
NM_005151 |
| Classification: |
Ubiquitin specific peptidases |
| Havana BLAST/BLAT: |
OTTHUMG00000178040 |