Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase 14, USP14 (N-6His)

Contact us
Catalog number: C191
Price: 2459 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase 14, USP14 (N-6His)
Quantity: 1000ug
Other quantities: 10 µg 121€ 50 µg 318€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human USP14 is produced by our E, coli expression system and the target gene encoding Asp91-Gln494 is expressed with a 6His tag at the N-terminus
Molecular Weight: 45 kD, 48
UniProt number: P54578
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 100 mM sodium chloride, 20% Glycerol, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: USP14 (N-6His), Ubiquitin Carboxyl-Terminal Hydrolase 14
Short name: USP14 (N-6His), Recombinant Ubiquitin Carboxyl-Terminal Hydrolase 14
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Ubiquitin Carboxyl-Terminal Hydrolase 14, ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (N-6His), recombinant H
Alternative technique: rec
Alternative to gene target: BT, Cell surfaces, TGT, USP14 and IDBG-259 and ENSG00000101557 and 9097, Usp14 and IDBG-128322 and ENSMUSG00000047879 and 59025, proteasome binding, this GO :0000502 and proteasome complex and cellular component this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0004221 and ubiquitin thiolesterase activity and molecular function this GO :0004843 and ubiquitin-specific protease activity and molecular function this GO :0004866 and endopeptidase inhibitor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006511 and ubiquitin-dependent protein catabolic process and biological process this GO :0007268 and synaptic transmission and biological process this GO :0008193 and tRNA guanylyltransferase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0009986 and cell surface and cellular component this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0016023 and cytoplasmic membrane-bounded vesicle and cellular component this GO :0016579 and protein deubiquitination and biological process this GO :0036459 and ubiquitinyl hydrolase activity and molecular function this GO :0045202 and synapse and cellular component this GO :0050920 and regulation of chemotaxis and biological process this GO :0061136 and regulation of proteasomal protein catabolic process and biological process this GO :0070628 and proteasome binding and molecular function, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0004221 : ubiquitin thiolesterase activity and also this GO :0004843 : ubiquitin-specific protease activity and also this GO :0004866 : endopeptidase inhibitor activity and also this GO :0005515 : protein binding and also this GO :0008193 : tRNA guanylyltransferase activity and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0036459 : ubiquitinyl hydrolase activity and also this GO :0070628 : proteasome binding, this GO :0004221 : ubiquitin thiolesterase activity, this GO :0004843 : ubiquitin-specific protease activity, this GO :0004866 : endopeptidase inhibitor activity, this GO :0005515 : protein binding, this GO :0008193 : tRNA guanylyltransferase activity, this GO :0008234 : cysteine-type peptidase activity, this GO :0036459 : ubiquitinyl hydrolase activity, this GO :0070628 : proteasome binding, 20599 and IDBG-644085 and ENSBTAG00000019214 and 505106, ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Identity: 12612
Gene: USP14 | More about : USP14
Long gene name: ubiquitin specific peptidase 14
Synonyms gene name: ubiquitin specific protease 14 (tRNA-guanine transglycosylase) ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Synonyms: TGT
Locus: 18p11, 32
Discovery year: 1999-02-01
GenBank acession: U30888
Entrez gene record: 9097
Pubmed identfication: 12838346
RefSeq identity: NM_005151
Classification: Ubiquitin specific peptidases
Havana BLAST/BLAT: OTTHUMG00000178040

Related Products :

C191 Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase 14, USP14 (N-6His) 500 µg 1613 € novo human
MBS623955 USP11, NT (R41) (Ubiquitin Carboxyl-terminal Hydrolase 11, Ubiquitin Thiolesterase 11, Deubiquitinating Enzyme 11, Ubiquitin-specific-processing Protease 11, UHX1) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS624491 USP12, CT (Ubiquitin Carboxyl-terminal Hydrolase 12, Ubiquitin Thiolesterase 12, Ubiquitin-specific Processing Protease 12, Deubiquitinating Enzyme 12, Ubiquitin Hydrolyzing Enzyme 1, UBH1, USP12L1) 200ul 603 € MBS Polyclonals_1 human
MBS623789 USP13, NT (Ubiquitin Carboxyl-terminal Hydrolase 13, Ubiquitin Thiolesterase 13, Ubiquitin-specific Processing Protease 13, Deubiquitinating Enzyme 13, Isopeptidase T-3, ISOT-3, ISOT3) 200ul 603 € MBS Polyclonals_1 human
MBS624138 USP19, CT (Ubiquitin Thiolesterase 19, Ubiquitin-specific Processing Protease 19, Deubiquitinating Enzyme 19, Ubiquitin Carboxyl-terminal Hydrolase 19, KIAA0891, ZMYND9) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623490 USP21, NT (P31) (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23) 200ul 597 € MBS Polyclonals_1 human
MBS623648 USP21, NT (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23) Antibody 200ul 603 € MBS Polyclonals_1 human
C188 Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L1, UCH-L1 (C-6His) 10 µg 100 € novo human
C189 Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3, UCH-L3 (C-6His) 50 µg 440 € novo human
MBS395526 Ubiquitin carboxyl-terminal hydrolase 2, Ubiquitin Specific Protease 2 (USP2) Antibody 50ug 597 € MBS Polyclonals_1 human
RP-986 Recombinant (E.Coli) Human Ubiquitin Carboxyl-Terminal Hydrolase L1 10 μg 405 € adi human
RP-772 Recombinant (E.Coli) Human Ubiquitin Carboxyl-Terminal Hydrolase L1 GST tag 2 μg 405 € adi human
abx263564 Anti-Ubiquitin Carboxyl-Terminal Hydrolase L1 GST tag Protein (Recombinant) 10 µg 862 € abbex human
abx166631 Anti-Ubiquitin Carboxyl Terminal Hydrolase L1 Protein (Recombinant) 50 μg 601 € abbex human
abx261425 Anti-Ubiquitin Carboxyl-Terminal Hydrolase L1 Protein (Recombinant) 5 µg 238 € abbex human
abx168423 Anti-Ubiquitin Carboxyl Terminal Hydrolase L4 Protein (Recombinant) 100 μg 876 € abbex human
DL-USP14-Hu Human Ubiquitin Specific Peptidase 14 USP14 ELISA Kit 96T 904 € DL elisas human
EKU08025 Ubiquitin Specific Peptidase 14 (USP14) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
abx251226 Anti-Human Ubiquitin carboxyl-terminal hydrolase isozyme L1 ELISA Kit inquire 50 € abbex human
MBS280075 Anti-Human Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1) PAb 100ug 536 € MBS Polyclonals_1 human
GENTAUR-58b8c602efb1e Human Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 (USP17L4) 100ug 2459 € MBS Recombinant Proteins human
GENTAUR-58b8c60350baf Human Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 (USP17L4) 1000ug 2459 € MBS Recombinant Proteins human
GENTAUR-58b8c603c1b91 Human Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 (USP17L4) 100ug 2973 € MBS Recombinant Proteins human
GENTAUR-58b8c6041f159 Human Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 (USP17L4) 1000ug 2973 € MBS Recombinant Proteins human
GENTAUR-58b9c6df0484e Human Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 (USP17L4) 100ug 2459 € MBS Recombinant Proteins human
GENTAUR-58b9c6df5f2f7 Human Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 (USP17L4) 1000ug 2459 € MBS Recombinant Proteins human
GENTAUR-58b9c6dfbd54c Human Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 (USP17L4) 100ug 2973 € MBS Recombinant Proteins human
GENTAUR-58b9c6e033179 Human Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 (USP17L4) 1000ug 2973 € MBS Recombinant Proteins human
GENTAUR-58ba4b2cc50e1 Human Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 7 (USP17L7) 100ug 2459 € MBS Recombinant Proteins human
GENTAUR-58ba4b2d81d83 Human Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 7 (USP17L7) 1000ug 2459 € MBS Recombinant Proteins human