Recombinant Human Major Prion Protein, PRP, CD230

Catalog number:	C164 Buy Now
Price:	558 €
Supplier:	acr
Product name:	Recombinant Human Major Prion Protein, PRP, CD230
Quantity:	50 Вµl
Other quantities:	1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:	human protein gene synonyms culture cell

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Major Prion Protein is produced by our E, coli expression system and the target gene encoding Gln91-Ser231 is expressed
Molecular Weight:	16, 25 kD
UniProt number:	P04156
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	200 mM sodium chloride, pH 7, 2 um filtered solution of 5 mM PB, 5, Lyophilized from a 0
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYVLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSS
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	CD230, PRP, Major Prion Protein
Short name:	CD230, PRP, Recombinant Major Prion Protein
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	CD230, PRP, sapiens Major Prion Protein, recombinant H
Alternative technique:	rec
Identity:	9449
Gene:	PRNP | More about : PRNP
Long gene name:	prion protein
Synonyms gene:	PRIP GSS CJD
Synonyms gene name:	prion protein (p27-30)
Synonyms:	CD230 PRP AltPrP
Synonyms name:	Creutzfeldt-Jakob disease Gerstmann-Strausler-Scheinker syndrome fatal familial insomnia p27-30
Locus:	20p13
Discovery year:	1986-01-01
GenBank acession:	M13899
Entrez gene record:	5621
RefSeq identity:	NM_000311
Classification:	CD molecules
Havana BLAST/BLAT:	OTTHUMG00000031786
Locus Specific Databases:	Prion Protein/CJD database

• #human
• #protein
• #gene
• #synonyms
• #culture
• #cell