Recombinant Human Major Prion Protein, PRP, CD230

Contact us
Catalog number: C164
Price: 558 €
Supplier: acr
Product name: Recombinant Human Major Prion Protein, PRP, CD230
Quantity: 50 Вµl
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Major Prion Protein is produced by our E, coli expression system and the target gene encoding Gln91-Ser231 is expressed
Molecular Weight: 16, 25 kD
UniProt number: P04156
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 200 mM sodium chloride, pH 7, 2 um filtered solution of 5 mM PB, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYVLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD230, PRP, Major Prion Protein
Short name: CD230, PRP, Recombinant Major Prion Protein
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD230, PRP, sapiens Major Prion Protein, recombinant H
Alternative technique: rec
Identity: 9449
Gene: PRNP | More about : PRNP
Long gene name: prion protein
Synonyms gene: PRIP GSS CJD
Synonyms gene name: prion protein (p27-30)
Synonyms: CD230 PRP AltPrP
Synonyms name: Creutzfeldt-Jakob disease Gerstmann-Strausler-Scheinker syndrome fatal familial insomnia p27-30
Locus: 20p13
Discovery year: 1986-01-01
GenBank acession: M13899
Entrez gene record: 5621
RefSeq identity: NM_000311
Classification: CD molecules
Havana BLAST/BLAT: OTTHUMG00000031786
Locus Specific Databases: Prion Protein/CJD database

Related Products :

C164 Recombinant Human Major Prion Protein, PRP, CD230 10 µg 156 € novo human
GENTAUR-58be5bb67d78b Anti-Prion protein PrP/CD230, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-11788R-A350 Prion protein PrP/CD230 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11788R-A488 Prion protein PrP/CD230 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11788R-A555 Prion protein PrP/CD230 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11788R-A594 Prion protein PrP/CD230 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11788R-A647 Prion protein PrP/CD230 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11788R-Biotin Prion protein PrP/CD230 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11788R Prion protein PrP/CD230 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-11788R-Cy3 Prion protein PrP/CD230 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11788R-Cy5 Prion protein PrP/CD230 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11788R-Cy5.5 Prion protein PrP/CD230 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11788R-Cy7 Prion protein PrP/CD230 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11788R-FITC Prion protein PrP/CD230 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11788R-HRP Prion protein PrP/CD230 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
AR50837PU-N anti-CD230 / PrP (23-230, His-tag) Antibody 0,1 mg 1109 € acr human
AR50837PU-S anti-CD230 / PrP (23-230, His-tag) Antibody 20 Вµg 485 € acr human
AM05042PU-N anti-CD230 / PrP (93-109) Antibody 0,1 ml 1544 € acr human
AM01216PU-N anti-CD230 / PrP Antibody 0,25 mg 674 € acr human
AM05764PU-N anti-CD230 / PrP Antibody 0,1 mg 688 € acr human
AM26026PU-N anti-CD230 / PrP Antibody 0,1 mg 500 € acr human
AP05815PU-N anti-CD230 / PrP Antibody 0,1 ml 529 € acr human
AP05815PU-S anti-CD230 / PrP Antibody 10 Вµl 340 € acr human
AP32838PU-N anti-CD230 / PrP Antibody 0,2 ml 471 € acr human
AP55194SU-N anti-CD230 / PrP Antibody 0,2 ml 630 € acr human
AP55195PU-N anti-CD230 / PrP Antibody 25 Вµg 674 € acr human
BB-PA1794 anti-CD230 / PrP Antibody 0,1 mg 471 € acr human
BB-PA1795 anti-CD230 / PrP Antibody 0,1 mg 471 € acr human
CH23027-200 anti-CD230 / PrP Antibody 0,2 ml 572 € acr human
DB 080-0.05 anti-CD230 / PrP Antibody 50 Вµl 558 € acr human