Recombinant Human Melanoma Inhibitory Activity Protein, MIA (C-6His)

Contact us
Catalog number: C150
Price: 2283 €
Supplier: novo
Product name: Recombinant Human Melanoma Inhibitory Activity Protein, MIA (C-6His)
Quantity: 1 mg
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Melanoma Inhibitory Activity Protein is produced by our E, coli expression system and the target gene encoding Gly25-Gln131 is expressed with a 6His tag at the C-terminus
Molecular Weight: 13, 31 kD
UniProt number: Q16674
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MIA (C-6His), Melanoma Inhibitory Activity Protein
Short name: MIA (C-6His), Recombinant Melanoma Inhibitory Activity Protein
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: MIA (C-6His), sapiens Melanoma Inhibitory Activity Protein, recombinant H
Alternative technique: rec
Identity: 7076
Gene: MIA | More about : MIA
Long gene name: melanoma inhibitory activity
Synonyms: CD-RAP
Locus: 19q13, 2
Discovery year: 1999-12-14
GenBank acession: X75450
Entrez gene record: 8190
Pubmed identfication: 7923218 8661134
Classification: MIA family
Havana BLAST/BLAT: OTTHUMG00000182693

Related Products :

C150 Recombinant Human Melanoma Inhibitory Activity Protein, MIA (C-6His) 1 mg 2283 € novo human
GWB-FD6478 Melanoma Inhibitory Activity (MIA) recombinant Human 1 vial 579 € genways human
MBS618109 Melanoma Inhibitory Activity Protein (MIA) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS615645 Melanoma Inhibitory Activity Protein (MIA) (Biotin) Antibody 0.025 miligrams 426 € MBS Polyclonals_1 human
GWB-1E6C14 Recombinant Human Melanoma Inhibitory Activity Protein 2 bulk Ask price € genways bulk human
abx260739 Anti-Melanoma Inhibitory Activity Protein 2 Protein (Recombinant) 20 µg 340 € abbex human
abx260772 Anti-Melanoma Inhibitory Activity Protein, His Tag Protein (Recombinant) 5 µg 238 € abbex human
abx167946 Anti-Melanoma Inhibitory Activity Protein 1 (Recombinant) 100 μg 934 € abbex human
abx261812 Anti-Melanoma Inhibitory Activity Protein (Recombinant) 20 µg 340 € abbex human
abx251618 Anti-Human Melanoma Inhibitory Activity Protein 1 ELISA Kit inquire 50 € abbex human
DL-MIA1-Hu Human Melanoma Inhibitory Activity Protein 1 MIA1 ELISA Kit 96T 904 € DL elisas human
abx130313 Anti-Melanoma Inhibitory Activity Protein 1 Antibody 50 μg 427 € abbex human
abx254938 Anti-Mouse Melanoma inhibitory activity protein 2 ELISA Kit inquire 50 € abbex mouse
EKU05896 Melanoma Inhibitory Activity Protein 1 (MIA1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU05897 Melanoma Inhibitory Activity Protein 1 (MIA1) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
EKU05898 Melanoma Inhibitory Activity Protein 1 (MIA1) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
DL-MIA1-Mu Mouse Melanoma Inhibitory Activity Protein 1 MIA1 ELISA Kit 96T 921 € DL elisas mouse
DL-MIA1-Ra Rat Melanoma Inhibitory Activity Protein 1 MIA1 ELISA Kit 96T 962 € DL elisas rat
MBS622973 RAMP1 (Receptor Activity Modifying Protein1, Receptor Activity Modifying Protein 1 [Precursor], Receptor (G Protein-coupled) Activity Modifying Protein 1, Calcitonin Receptor-like Receptor Activity Modifying Protein 1, CRLR Activity Modifying Protein 1) Antibody 100ug 591 € MBS Polyclonals_1 human
BMDV10152 Melan-A, MART-1 (Melanoma Antigen Recognized by T-cells 1), Melanoma Marker, 18kD, Clone: M2-7C10, Mouse Monoclonal antibody-Human, Horse, NO X w/Mouse or Rat; paraffin, IH/WB/flow/IP (denatured) 500ul 808 € accurate-monoclonals rat
ICCMC3 Melanoma Marker, in cytoplasm of Melanoma Cells & Nevocellular Nevi, Clone: NKI/C3, Mouse Monoclonal antibody- 1000ul 465 € accurate-monoclonals mouse
SP-101812-1 [Tyr0] Gastric Inhibitory Peptide (23-42), human; [Tyr22] Gastric Inhibitory Peptide (22-42), human [Tyr-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; MW 2584.9] 1 mg 188 € adi human
CE69 Recombinant Human MAP3K12-Binding Inhibitory Protein 1, MBIPP (N-6His) 500 µg 1613 € novo human
GWB-BIG0D1 Recombinant Human MIA-2 bulk Ask price € genways bulk human
GWB-BIG0D0 Recombinant Human MIA bulk Ask price € genways bulk human
C396 Recombinant Human Wnt Inhibitory Factor 1, WIF-1 (C-6His) 10 µg 131 € novo human
MBS623127 Leukemia Inhibitory Factor (LIF, Cholinergic Differentiation Factor, CDF, DIA, Differentiation-stimulating Factor, D Factor, HILDA, Melanoma-derived LPL Inhibitor, MLPLI) Antibody 100ug 564 € MBS Polyclonals_1 human
ZR-40-227 MIA-2 Recombinant Protein 0.005 mg 256 € Zyagen human
ZR-40-226 MIA Recombinant Protein 0.005 mg 256 € Zyagen human
CH27 Recombinant Mouse Macrophage Migration Inhibitory Factor, MIF (C-6His) 1 mg 2283 € novo mouse