| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Macrophage migration inhibitory factor is produced by our E, coli expression system and the target gene encoding Pro2-Ala115 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
13, 5 kD |
| UniProt number: |
P34884 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFALEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
MIF (C-6His), Macrophage Migration Inhibitory Factor |
| Short name: |
MIF (C-6His), Recombinant Mouse Macrophage Migration Inhibitory Factor |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
macrophage migration inhibitory factor (glycosylation-inhibiting factor) (C-6His), recombinant Mouse Macrophage Migration Inhibitory Factor |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, GIF and GLIF and MMIF, MIF and IDBG-401910 and ENSG00000240972 and 4282, MIF and IDBG-637094 and ENSBTAG00000007375 and 280858, Mif and IDBG-163956 and ENSMUSG00000033307 and 17319, phenylpyruvate tautomerase activity, signal transduction by p53 class mediator and biological process this GO :0030890 and positive regulation of B cell proliferation and biological process this GO :0031666 and positive regulation of lipopolysaccharide-mediated signaling pathway and biological process this GO :0032269 and negative regulation of cellular protein metabolic process and biological process this GO :0033033 and negative regulation of myeloid cell apoptotic process and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0042127 and regulation of cell proliferation and biological process this GO :0042327 and positive regulation of phosphorylation and biological process this GO :0043030 and regulation of macrophage activation and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0043518 and negative regulation of DNA damage response, signal transduction by p53 class mediator and biological process this GO :0045087 and innate immune response and biological process this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0050178 and phenylpyruvate tautomerase activity and molecular function this GO :0050715 and positive regulation of cytokine secretion and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050918 and positive chemotaxis and biological process this GO :0061078 and positive regulation of prostaglandin secretion involved in immune response and biological process this GO :0061081 and positive regulation of myeloid leukocyte cytokine production involved in immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070207 and protein homotrimerization and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071157 and negative regulation of cell cycle arrest and biological process this GO :0090238 and positive regulation of arachidonic acid secretion and biological process this GO :0090344 and negative regulation of cell aging and biological process this GO :1902166 and negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator and biological process this GO :2000343 and positive regulation of chemokine (C-X-C motif) ligand 2 production and biological process, this GO :0001516 and prostaglandin biosynthetic process and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002906 and negative regulation of mature B cell apoptotic process and biological process this GO :0004167 and dopachrome isomerase activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005126 and cytokine receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007569 and cell aging and biological process this GO :0008283 and cell proliferation and biological process this GO :0009986 and cell surface and cellular component this GO :0010629 and negative regulation of gene expression and biological process this GO :0010739 and positive regulation of protein kinase A signaling and biological process this GO :0019752 and carboxylic acid metabolic process and biological process this GO :0030330 and DNA damage response, this GO :0004167 : dopachrome isomerase activity, this GO :0004167 : dopachrome isomerase activity and also this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005126 : cytokine receptor binding and also this GO :0005515 : protein binding and also this GO :0042056 : chemoattractant activity and also this GO :0050178 : phenylpyruvate tautomerase activity, this GO :0005102 : receptor binding, this GO :0005125 : cytokine activity, this GO :0005126 : cytokine receptor binding, this GO :0005515 : protein binding, this GO :0042056 : chemoattractant activity, this GO :0050178 : phenylpyruvate tautomerase activity, macrophage migration inhibitory factor (glycosylation-inhibiting factor) |
| Identity: |
7097 |
| Gene: |
MIF |
More about : MIF |
| Long gene name: |
macrophage migration inhibitory factor (glycosylation-inhibiting factor) |
| Synonyms gene: |
GLIF |
| Synonyms: |
GIF |
| Locus: |
22q11, 23 |
| Discovery year: |
1993-10-15 |
| GenBank acession: |
M25639 |
| Entrez gene record: |
4282 |
| Pubmed identfication: |
7558020 2552447 |
| RefSeq identity: |
NM_002415 |
| Havana BLAST/BLAT: |
OTTHUMG00000150773 |