Recombinant Human β-Defensin 1, DEFB1

Contact us
Catalog number: C125
Price: 671 €
Supplier: abebio
Product name: Recombinant Human β-Defensin 1, DEFB1
Quantity: 1x plate of 96 wells
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human beta-Defensin 1 is produced by our E, coli expression system and the target gene encoding Gly22-Lys68 is expressed
Molecular Weight: 07 kD, 5
UniProt number: P60022
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 130 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: DEFB1, &beta, -Defensin 1
Short name: DEFB1, -Defensin 1, Recombinant &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: b 1, defensin, sapiens &beta, -Defensin 1, recombinant H
Alternative technique: rec
Alternative to gene target: BD1 and DEFB-1 and DEFB101 and HBD1, DEFB1 and IDBG-5986 and ENSG00000164825 and 1672, Defb1 and IDBG-139170 and ENSMUSG00000044748 and 13214, Extracellular, beta 1, this GO :0002227 and innate immune response in mucosa and biological process this GO :0002526 and acute inflammatory response and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005796 and this GO lgi lumen and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006952 and defense response and biological process this GO :0006955 and immune response and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0009617 and response to bacterium and biological process this GO :0019731 and antibacterial humoral response and biological process this GO :0033574 and response to testosterone and biological process this GO :0045087 and innate immune response and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, defensin
Identity: 2766
Gene: DEFB1 | More about : DEFB1
Long gene name: defensin beta 1
Synonyms gene name: beta 1 , defensin
Synonyms: HBD-1 DEFB-1 DEFB101 HBD1 BD1 MGC51822
Synonyms name: beta-defensin 1 beta defensin 1
Locus: 8p23, 1
Discovery year: 1997-05-29
GenBank acession: X92744
Entrez gene record: 1672
Pubmed identfication: 7628632
RefSeq identity: NM_005218
Classification: Defensins, beta
Havana BLAST/BLAT: OTTHUMG00000090367

Related Products :

C125 Recombinant Human β-Defensin 1, DEFB1 1 mg 2283 € novo human
abx576017 Anti-Human Defensin Beta 1 (DEFb1) ELISA Kit inquire 50 € abbex human
DL-DEFb1-Hu Human Defensin Beta 1 DEFb1 ELISA Kit 96T 869 € DL elisas human
abx574020 Anti-Cow Defensin Beta 1 (DEFb1) ELISA Kit inquire 50 € abbex cow
GENTAUR-58bdc34d0e4ab Anti- Defensin Beta 1 (DEFb1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc3f948d89 Anti- Defensin Beta 1 (DEFb1) Antibody 100ug 586 € MBS Polyclonals human
GENTAUR-58bdc7f792a1a Anti- Defensin Beta 1 (DEFb1) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc7f828206 Anti- Defensin Beta 1 (DEFb1) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcb6d2b191 Anti- Defensin Beta 1 (DEFb1) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdcb6d80e3e Anti- Defensin Beta 1 (DEFb1) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcdf5bda08 Anti- Defensin Beta 1 (DEFb1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdcdf6241df Anti- Defensin Beta 1 (DEFb1) Antibody 50ug 409 € MBS Polyclonals human
GENTAUR-58bdcea7669fb Anti- Defensin Beta 1 (DEFb1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd4e74faad Anti- Defensin Beta 1 (DEFb1) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd71d5a32c Anti- Defensin Beta 1 (DEFb1) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdda4d8f8b0 Anti- Defensin Beta 1 (DEFb1) Antibody 100ug 625 € MBS Polyclonals human
abx575337 Anti-Mouse Defensin Beta 1 (DEFb1) ELISA Kit inquire 50 € abbex mouse
abx573862 Anti-Pig Defensin Beta 1 (DEFb1) ELISA Kit 96 tests 876 € abbex pig
abx573442 Anti-Rat Defensin Beta 1 (DEFb1) ELISA Kit inquire 50 € abbex rat
DL-DEFb1-b Bovine Defensin Beta 1 DEFb1 ELISA Kit 96T 1020 € DL elisas bovine
EKU03655 Defensin Beta 1 (DEFb1) ELISA kit 1 plate of 96 wells 930 € Biomatik ELISA kits human
EKU03656 Defensin Beta 1 (DEFb1) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU03657 Defensin Beta 1 (DEFb1) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU03658 Defensin Beta 1 (DEFb1) ELISA kit 1 plate of 96 wells 930 € Biomatik ELISA kits human
EKU03659 Defensin Beta 1 (DEFb1) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
AE47508GO-48 ELISA test for Goat Beta-defensin 1 (DEFB1) 1x plate of 48 wells 402 € abebio human
GENTAUR-58bd190dacd04 Goat Beta-defensin 1 (DEFB1) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd190e0630a Goat Beta-defensin 1 (DEFB1) 1000ug 2078 € MBS Recombinant Proteins human
AE47508GO Goat Beta-defensin 1 (DEFB1) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE47508GO-96 Goat Beta-defensin 1 (DEFB1) ELISA Kit 1x plate of 96 wells 671 € abebio human