| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human beta-Defensin 1 is produced by our E, coli expression system and the target gene encoding Gly22-Lys68 is expressed |
| Molecular Weight: |
07 kD, 5 |
| UniProt number: |
P60022 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
130 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
DEFB1, &beta, -Defensin 1 |
| Short name: |
DEFB1, -Defensin 1, Recombinant &beta |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
b 1, defensin, sapiens &beta, -Defensin 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BD1 and DEFB-1 and DEFB101 and HBD1, DEFB1 and IDBG-5986 and ENSG00000164825 and 1672, Defb1 and IDBG-139170 and ENSMUSG00000044748 and 13214, Extracellular, beta 1, this GO :0002227 and innate immune response in mucosa and biological process this GO :0002526 and acute inflammatory response and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005796 and this GO lgi lumen and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006952 and defense response and biological process this GO :0006955 and immune response and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0009617 and response to bacterium and biological process this GO :0019731 and antibacterial humoral response and biological process this GO :0033574 and response to testosterone and biological process this GO :0045087 and innate immune response and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, defensin |
| Identity: |
2766 |
| Gene: |
DEFB1 |
More about : DEFB1 |
| Long gene name: |
defensin beta 1 |
| Synonyms gene name: |
beta 1 , defensin |
| Synonyms: |
HBD-1 DEFB-1 DEFB101 HBD1 BD1 MGC51822 |
| Synonyms name: |
beta-defensin 1 beta defensin 1 |
| Locus: |
8p23, 1 |
| Discovery year: |
1997-05-29 |
| GenBank acession: |
X92744 |
| Entrez gene record: |
1672 |
| Pubmed identfication: |
7628632 |
| RefSeq identity: |
NM_005218 |
| Classification: |
Defensins, beta |
| Havana BLAST/BLAT: |
OTTHUMG00000090367 |