Recombinant Human Apurinic-Apyrimidinic Endonuclease 1, APE

Contact us
Catalog number: C101
Price: 1912 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Apurinic-Apyrimidinic Endonuclease 1, APE
Quantity: 1000ug
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Apurinic-Apyrimidinic Endonuclease 1 is produced by our E, coli expression system and the target gene encoding Pro2-Leu318 is expressed
Molecular Weight: 35, 62 kD
UniProt number: P27695
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 100 mM KCl, 50% Glycerol, pH 7, 2 um filtered solution of 10 mM HEPES, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: APE, Apurinic-Apyrimidinic Endonuclease 1
Short name: APE, Recombinant Apurinic-Apyrimidinic Endonuclease 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: APE, sapiens Apurinic-Apyrimidinic Endonuclease 1, recombinant H
Alternative technique: rec
Identity: 587
Gene: APEX1 | More about : APEX1
Long gene name: apurinic/apyrimidinic endodeoxyribonuclease 1
Synonyms gene: APEX
Synonyms gene name: APEX nuclease (multifunctional DNA repair enzyme) APEX nuclease (multifunctional DNA repair enzyme) 1
Synonyms: APE REF1 HAP1 APX APEN REF-1 APE-1
Locus: 14q11, 2
Discovery year: 1997-05-22
GenBank acession: X59764
Entrez gene record: 328
RefSeq identity: NM_001641
Havana BLAST/BLAT: OTTHUMG00000029544
Locus Specific Databases: ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

Related Products :

C101 Recombinant Human Apurinic-Apyrimidinic Endonuclease 1, APE 10 µg 156 € novo human
MBS622118 Nei Endonuclease VIII-like 1 (DNA (Apurinic or Apyrimidinic Site) Lyase Neil1, DNA Glycosylase/AP Lyase Neil1, Endonuclease VIII, Endonuclease VIII-like 1, FLJ22402, FPG1, hFPG1, NEH1, NEI1, Nei-like 1) Antibody 100ug 735 € MBS Polyclonals_1 human
APE11-S Rabbit Anti-Human AP Endonuclease (APE/APEX/APE-1) antiserum #1 100 μL 536 € adi human
GWB-9E866F APEX Nuclease (Apurinic/Apyrimidinic Endonuclease) 2 (APEX2) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
APE12-S Rabbit Anti-Mouse AP Endonuclease (APE/APEX/APE-1) protein antiserum #2 100 μL 536 € adi mouse
abx251333 Anti-Human DNA-(apurinic or apyrimidinic site) lyase ELISA Kit inquire 50 € abbex human
GENTAUR-58bab22dcda2a Aeropyrum pernix Uncharacterized protein APE_1276 (APE_1276) 100ug 2056 € MBS Recombinant Proteins human
GENTAUR-58bab22e58b8b Aeropyrum pernix Uncharacterized protein APE_1276 (APE_1276) 1000ug 2056 € MBS Recombinant Proteins human
GENTAUR-58bab22f4a79a Aeropyrum pernix Uncharacterized protein APE_1276 (APE_1276) 100ug 2569 € MBS Recombinant Proteins human
GENTAUR-58bab22fa068e Aeropyrum pernix Uncharacterized protein APE_1276 (APE_1276) 1000ug 2569 € MBS Recombinant Proteins human
GENTAUR-58bc76585a452 Aeropyrum pernix UPF0175 protein APE_0276a (APE_0276a) 100ug 1337 € MBS Recombinant Proteins human
GENTAUR-58bc76588cc73 Aeropyrum pernix UPF0175 protein APE_0276a (APE_0276a) 1000ug 1337 € MBS Recombinant Proteins human
GENTAUR-58bc7658cd586 Aeropyrum pernix UPF0175 protein APE_0276a (APE_0276a) 100ug 1846 € MBS Recombinant Proteins human
GENTAUR-58bc765921185 Aeropyrum pernix UPF0175 protein APE_0276a (APE_0276a) 1000ug 1846 € MBS Recombinant Proteins human
MBS622762 APE-1 (Apurinic Endonuclase Factor 1) Antibody 0.04 mg 370 € MBS Polyclonals_1 human
GENTAUR-58bca6409527d Dictyostelium discoideum DNA- (apurinic or apyrimidinic site) lyase 100ug 2028 € MBS Recombinant Proteins human
GENTAUR-58bca640dd72e Dictyostelium discoideum DNA- (apurinic or apyrimidinic site) lyase 1000ug 2028 € MBS Recombinant Proteins human
GENTAUR-58bca6412d886 Dictyostelium discoideum DNA- (apurinic or apyrimidinic site) lyase 100ug 2542 € MBS Recombinant Proteins human
GENTAUR-58bca6416243f Dictyostelium discoideum DNA- (apurinic or apyrimidinic site) lyase 1000ug 2542 € MBS Recombinant Proteins human
AE56100RA-48 ELISA test for Rat DNA- (apurinic or apyrimidinic site) lyase (APEX1) 1x plate of 48 wells 373 € abebio rat
GENTAUR-58b9aa525ba7c Gorilla gorilla gorilla DNA- (apurinic or apyrimidinic site) lyase 100ug 1912 € MBS Recombinant Proteins human
GENTAUR-58b9aa52bcda6 Gorilla gorilla gorilla DNA- (apurinic or apyrimidinic site) lyase 1000ug 1912 € MBS Recombinant Proteins human
GENTAUR-58b9aa531a605 Gorilla gorilla gorilla DNA- (apurinic or apyrimidinic site) lyase 100ug 2426 € MBS Recombinant Proteins human
GENTAUR-58b9aa536de1d Gorilla gorilla gorilla DNA- (apurinic or apyrimidinic site) lyase 1000ug 2426 € MBS Recombinant Proteins human
GENTAUR-58ba265405081 Gorilla gorilla gorilla DNA- (apurinic or apyrimidinic site) lyase 100ug 1912 € MBS Recombinant Proteins human
GENTAUR-58ba265465fa5 Gorilla gorilla gorilla DNA- (apurinic or apyrimidinic site) lyase 1000ug 1912 € MBS Recombinant Proteins human
GENTAUR-58ba2654d08f7 Gorilla gorilla gorilla DNA- (apurinic or apyrimidinic site) lyase 100ug 2426 € MBS Recombinant Proteins human
GENTAUR-58ba26556af9e Gorilla gorilla gorilla DNA- (apurinic or apyrimidinic site) lyase 1000ug 2426 € MBS Recombinant Proteins human
GENTAUR-58b9b48d55c6d Pan paniscus DNA- (apurinic or apyrimidinic site) lyase 100ug 1912 € MBS Recombinant Proteins human
GENTAUR-58b9b48dd12c6 Pan paniscus DNA- (apurinic or apyrimidinic site) lyase 1000ug 1912 € MBS Recombinant Proteins human