| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Apurinic-Apyrimidinic Endonuclease 1 is produced by our E, coli expression system and the target gene encoding Pro2-Leu318 is expressed |
| Molecular Weight: |
35, 62 kD |
| UniProt number: |
P27695 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
100 mM KCl, 50% Glycerol, pH 7, 2 um filtered solution of 10 mM HEPES, 4, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
APE, Apurinic-Apyrimidinic Endonuclease 1 |
| Short name: |
APE, Recombinant Apurinic-Apyrimidinic Endonuclease 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
APE, sapiens Apurinic-Apyrimidinic Endonuclease 1, recombinant H |
| Alternative technique: |
rec |
| Identity: |
587 |
| Gene: |
APEX1 |
More about : APEX1 |
| Long gene name: |
apurinic/apyrimidinic endodeoxyribonuclease 1 |
| Synonyms gene: |
APEX |
| Synonyms gene name: |
APEX nuclease (multifunctional DNA repair enzyme) APEX nuclease (multifunctional DNA repair enzyme) 1 |
| Synonyms: |
APE REF1 HAP1 APX APEN REF-1 APE-1 |
| Locus: |
14q11, 2 |
| Discovery year: |
1997-05-22 |
| GenBank acession: |
X59764 |
| Entrez gene record: |
328 |
| RefSeq identity: |
NM_001641 |
| Havana BLAST/BLAT: |
OTTHUMG00000029544 |
| Locus Specific Databases: |
ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database |