| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CNTF is produced by our E, coli expression system and the target gene encoding Ala2-Met200 is expressed |
| Molecular Weight: |
22, 93 kD |
| UniProt number: |
P26441 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
1 mM Cysteine, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CNTF, Ciliary Neurotrophic Factor |
| Short name: |
CNTF, Recombinant Ciliary Neurotrophic Factor |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
ciliary neurotrophic factor, sapiens Ciliary Neurotrophic Factor, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CNTF and IDBG-409278 and ENSG00000242689 and 1270, CNTF and IDBG-637978 and ENSBTAG00000003624 and 100848228, Cntf and IDBG-254935 and ENSMUSG00000079415 and 12803, Extracellular, HCNTF, growth factor activity, this GO :0005127 and ciliary neurotrophic factor receptor binding and molecular function this GO :0005138 and interleukin-6 receptor binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0007165 and signal transduction and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0040007 and growth and biological process this GO :0042517 and positive regulation of tyrosine phosphorylation of Stat3 protein and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0046533 and negative regulation of photoreceptor cell differentiation and biological process this GO :0046668 and regulation of retinal cell programmed cell death and biological process this GO :0048644 and muscle organ morphogenesis and biological process this GO :0048666 and neuron development and biological process this GO :0070120 and ciliary neurotrophic factor-mediated signaling pathway and biological process this GO :0097058 and CRLF-CLCF1 complex and cellular component, this GO :0005127 : ciliary neurotrophic factor receptor binding, this GO :0005127 : ciliary neurotrophic factor receptor binding and also this GO :0005138 : interleukin-6 receptor binding and also this GO :0008083 : growth factor activity, this GO :0005138 : interleukin-6 receptor binding, this GO :0008083 : growth factor activity, ciliary neurotrophic factor |
| Identity: |
2169 |
| Gene: |
CNTF |
More about : CNTF |
| Long gene name: |
ciliary neurotrophic factor |
| Synonyms: |
HCNTF |
| Locus: |
11q12, 1 |
| Discovery year: |
1991-01-07 |
| GenBank acession: |
BC068030 |
| Entrez gene record: |
1270 |
| Pubmed identfication: |
1840538 1714745 |
| RefSeq identity: |
NM_000614 |
| Classification: |
Interleukin 6 cytokine family |
| Havana BLAST/BLAT: |
OTTHUMG00000137476 |
| Locus Specific Databases: |
ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database |