Recombinant Human Ciliary Neurotrophic Factor, CNTF

Contact us
Catalog number: C098
Price: 764 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Human Ciliary Neurotrophic Factor, CNTF
Quantity: 1 plate of 96 wells
Other quantities: 10 µg 168€ 50 µg 405€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CNTF is produced by our E, coli expression system and the target gene encoding Ala2-Met200 is expressed
Molecular Weight: 22, 93 kD
UniProt number: P26441
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM Cysteine, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CNTF, Ciliary Neurotrophic Factor
Short name: CNTF, Recombinant Ciliary Neurotrophic Factor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ciliary neurotrophic factor, sapiens Ciliary Neurotrophic Factor, recombinant H
Alternative technique: rec
Alternative to gene target: CNTF and IDBG-409278 and ENSG00000242689 and 1270, CNTF and IDBG-637978 and ENSBTAG00000003624 and 100848228, Cntf and IDBG-254935 and ENSMUSG00000079415 and 12803, Extracellular, HCNTF, growth factor activity, this GO :0005127 and ciliary neurotrophic factor receptor binding and molecular function this GO :0005138 and interleukin-6 receptor binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0007165 and signal transduction and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0040007 and growth and biological process this GO :0042517 and positive regulation of tyrosine phosphorylation of Stat3 protein and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0046533 and negative regulation of photoreceptor cell differentiation and biological process this GO :0046668 and regulation of retinal cell programmed cell death and biological process this GO :0048644 and muscle organ morphogenesis and biological process this GO :0048666 and neuron development and biological process this GO :0070120 and ciliary neurotrophic factor-mediated signaling pathway and biological process this GO :0097058 and CRLF-CLCF1 complex and cellular component, this GO :0005127 : ciliary neurotrophic factor receptor binding, this GO :0005127 : ciliary neurotrophic factor receptor binding and also this GO :0005138 : interleukin-6 receptor binding and also this GO :0008083 : growth factor activity, this GO :0005138 : interleukin-6 receptor binding, this GO :0008083 : growth factor activity, ciliary neurotrophic factor
Identity: 2169
Gene: CNTF | More about : CNTF
Long gene name: ciliary neurotrophic factor
Synonyms: HCNTF
Locus: 11q12, 1
Discovery year: 1991-01-07
GenBank acession: BC068030
Entrez gene record: 1270
Pubmed identfication: 1840538 1714745
RefSeq identity: NM_000614
Classification: Interleukin 6 cytokine family
Havana BLAST/BLAT: OTTHUMG00000137476
Locus Specific Databases: ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

Related Products :

MBS610630 CNTFR (CNTFR, ciliary neurotrophic factor receptor, MGC1774, CNTFR alpha, ciliary neurotrophic factor receptor alpha precursor) 100ug 735 € MBS Polyclonals_1 human
C098 Recombinant Human Ciliary Neurotrophic Factor, CNTF 10 µg 168 € novo human
abx575778 Anti-Human Ciliary Neurotrophic Factor (CNTF) ELISA Kit 96 tests 586 € abbex human
GWB-4DE1FA Ciliary Neurotrophic Factor (CNTF) Rabbit antibody to or anti-Human Polyclonal (biotin conjugated) antibody 1 x 1 vial 602 € genways human
DL-CNTF-Hu Human Ciliary Neurotrophic Factor CNTF ELISA Kit 96T 672 € DL elisas human
GENTAUR-58bdc338eb606 Anti- Ciliary Neurotrophic Factor (CNTF) Antibody 100ug 359 € MBS Polyclonals human
GENTAUR-58bdc339545f1 Anti- Ciliary Neurotrophic Factor (CNTF) Antibody 50ug 293 € MBS Polyclonals human
GENTAUR-58bdc44e18aec Anti- Ciliary Neurotrophic Factor (CNTF) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc44e780c3 Anti- Ciliary Neurotrophic Factor (CNTF) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc730937d7 Anti- Ciliary Neurotrophic Factor (CNTF) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc730ed2a4 Anti- Ciliary Neurotrophic Factor (CNTF) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdc953d6c28 Anti- Ciliary Neurotrophic Factor (CNTF) Antibody 100ug 376 € MBS Polyclonals human
GENTAUR-58bdce730dfdc Anti- Ciliary Neurotrophic Factor (CNTF) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd31b384cf Anti- Ciliary Neurotrophic Factor (CNTF) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd75231640 Anti- Ciliary Neurotrophic Factor (CNTF) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddc1e2028d Anti- Ciliary Neurotrophic Factor (CNTF) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bddc3c0a360 Anti- Ciliary Neurotrophic Factor (CNTF) Antibody 100ug 520 € MBS Polyclonals human
abx575745 Anti-Mouse Ciliary Neurotrophic Factor (CNTF) ELISA Kit inquire 50 € abbex mouse
abx576039 Anti-Pig Ciliary Neurotrophic Factor (CNTF) ELISA Kit inquire 50 € abbex pig
abx575735 Anti-Rat Ciliary Neurotrophic Factor (CNTF) ELISA Kit inquire 50 € abbex rat
GWB-6825B9 antibody to or anti- Ciliary Neurotrophic Factor (CNTF) Rat antibody 1 tube 845 € genways rat
GWB-7AD85E antibody to or anti- Ciliary Neurotrophic Factor (CNTF) Receptor a antibody 1 tube 971 € genways human
DL-CNTF-Ch Chicken Ciliary Neurotrophic Factor CNTF ELISA Kit 96T 904 € DL elisas chicken
E-EL-Ch0599 Chicken CNTF (Ciliary Neurotrophic Factor) ELISA Kit 96T 568 € elabsciences chicken
GENTAUR-58be1ee88c85d Ciliary Neurotrophic Factor (CNTF) 500ug 453 € MBS mono human
GWB-8EA8A0 Ciliary Neurotrophic Factor (CNTF) 1 vial 579 € genways human
GENTAUR-58be1ee817ed2 Ciliary Neurotrophic Factor (CNTF) Antibody 500ug 453 € MBS mono human
EKU03190 Ciliary Neurotrophic Factor (CNTF) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU03191 Ciliary Neurotrophic Factor (CNTF) ELISA kit 1 plate of 96 wells 541 € Biomatik ELISA kits human
EKU03192 Ciliary Neurotrophic Factor (CNTF) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human