Recombinant Human Cystatin A (N-6His)

Contact us
Catalog number: C087
Price: 847 €
Supplier: abbex
Product name: Recombinant Human Cystatin A (N-6His)
Quantity: 100 μg
Other quantities: 10 µg 131€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cystatin A is produced by our E, coli expression system and the target gene encoding Ile2-Phe98 is expressed with a 6His tag at the N-terminus
Molecular Weight: 11, 8 kD
UniProt number: P01040
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Cystatin A (N-6His)
Short name: Recombinant Cystatin A (N-6His)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Cystatin A (N-6His), recombinant H
Alternative technique: rec

Related Products :

C087 Recombinant Human Cystatin A (N-6His) 500 µg 1613 € novo human
CI55 Recombinant Human Cystatin C, CST3 (C-6His) 50 µg 496 € novo human
CE75 Recombinant Human Cystatin C, CST3 (N-6His) 1 mg 2283 € novo human
C397 Recombinant Human Cystatin D, CSTD, CST5 (C-6His) 10 µg 202 € novo human
C334 Recombinant Human Cystatin F, CST7 (C-6His) 50 µg 496 € novo human
C333 Recombinant Human Cystatin M, CST6 (C-6His) 10 µg 202 € novo human
C335 Recombinant Human Cystatin S, CST4 (C-6His) 500 µg 1613 € novo human
C336 Recombinant Human Cystatin SA, CST2 (C-6His) 10 µg 202 € novo human
C462 Recombinant Human Cystatin SN, CST1 (C-6His) 1 mg 2283 € novo human
CR02 Recombinant Mouse Cystatin 8, CST8 (N-6His) 50 µg 496 € novo mouse
CD44 Recombinant Mouse Cystatin E, CST6 (C-6His) 10 µg 202 € novo mouse
CD20 Recombinant Mouse Cystatin F, CST7 (C-6His) 500 µg 1613 € novo mouse
CS25 Recombinant Human Cystatin C, CST3 (Human Cells) 500 µg 1755 € novo human
RP-970 Recombinant (E.Coli, GST tag) Human Cystatin-A/Stefin A 2 μg 405 € adi human
RP-0521H Recombinant Human Cystatin 7 / CST7 Protein 10μg 624 € adv human
RP-0522H Recombinant Human Cystatin 7 / CST7 Protein (Fc Tag) 10μg 624 € adv human
RP-0520H Recombinant Human Cystatin 7 / CST7 Protein (His Tag) 10μg 624 € adv human
GWB-BFEDC0 Recombinant Human Cystatin-B bulk Ask price € genways bulk human
RP-0523H Recombinant Human Cystatin B / CSTB Protein (His Tag) 50μg 624 € adv human
GWB-2E75DA Recombinant Human Cystatin C bulk Ask price € genways bulk human
GWB-3B9480 recombinant HUMAN CYSTATIN C 1 x 1 vial 1163 € genways human
CR17 Recombinant Human Cystatin C, CST3 (E.coli) 1 mg 2486 € novo human
RP-0524H Recombinant Human Cystatin C / CST3 Protein (His Tag) 10μg 624 € adv human
RP-0525H Recombinant Human Cystatin D / CST5 Protein (His Tag) 10μg 624 € adv human
RP-0505H Recombinant Human Cystatin E / CST6 Protein (His Tag) 10μg 624 € adv human
RP-0526H Recombinant Human Cystatin S / CST4 Protein (His Tag) 50μg 624 € adv human
RP-0527H Recombinant Human Cystatin SA / CST2 Protein (His Tag) 10μg 624 € adv human
abx262588 Anti-Canine Cystatin-C Protein (Recombinant) 1 mg 6662 € abbex human
abx261075 Anti-Cystatin 11 Protein (Recombinant) 20 µg 340 € abbex human
abx168357 Anti-Cystatin 3 Protein (Recombinant) 100 μg 847 € abbex human