Recombinant Human C-C Motif Chemokine 27, CCL27

Contact us
Catalog number: C065
Price: 1755 €
Supplier: novo
Product name: Recombinant Human C-C Motif Chemokine 27, CCL27
Quantity: 500 µg
Other quantities: 10 µg 168€ 50 µg 405€ 500 µg 1298€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 1 kD, 10
UniProt number: Q9Y4X3
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 500 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CCL27, C-C Motif Chemokine 27
Short name: CCL27, Recombinant C-C Motif Chemokine 27
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: chemokine (C-C motif) ligand 27, sapiens C-C Motif Chemokine 27, recombinant H
Alternative technique: rec
Alternative to gene target: ALP and CTACK and CTAK and ESKINE and ILC and PESKY and SCYA27, CCL27 and IDBG-236604 and ENSG00000213927 and 10850, CCL27 and IDBG-635969 and ENSBTAG00000014908 and 101902682, Extracellular, chemokine activity, this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006955 and immune response and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0060326 and cell chemotaxis and biological process, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity, chemokine (C-C motif) ligand 27
Identity: 10626
Gene: CCL27 | More about : CCL27
Long gene name: C-C motif chemokine ligand 27
Synonyms gene: SCYA27
Synonyms gene name: member 27 chemokine (C-C motif) ligand 27 , small inducible cytokine subfamily A (Cys-Cys)
Synonyms: ALP ILC CTACK skinkine ESkine PESKY CTAK
Synonyms name: CC chemokine ILC IL-11 Ralpha-locus chemokine cutaneous T-cell attracting chemokine
Locus: 9p13, 3
Discovery year: 1999-07-30
GenBank acession: AJ243542
Entrez gene record: 10850
Pubmed identfication: 10556532 10588729
RefSeq identity: NM_006664
Classification: Endogenous ligands Chemokine ligands
Havana BLAST/BLAT: OTTHUMG00000019834

Related Products :

MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
C065 Recombinant Human C-C Motif Chemokine 27, CCL27 10 µg 168 € novo human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58be31bbb4dcf CCR8, loop2 (chemokine receptor 8, C-C chemokine receptor type 8, CC-CKR-8, C-C CKR-8, CCR-8, CDw198, Chemokine receptor-like 1, CKRL1) Antibody 100ul 707 € MBS mono human
MBS611205 LEC, NCC-4 (Liver-Expressed Chemokine, New Chemokine CC-4, Small Inducible Cytokine Subfamily A (Cys X Cys) member 16, SCYA16, IL-10-inducible Chemokine, Monotactin-1) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS619083 BCA-1 (B Cell Attracting Chemokine 1, BCA1, B Lymphocyte Chemoattractant, ANGIE, ANGIE2, BLC, BLR1 Ligand, BLR1L, Chemokine (C-X-C Motif) Ligand 13 (B-cell Chemoattractant), C-X-C Motif Chemokine 13, CXCL13, CXC Chemokine BLC, Small Inducible Cytokine B S Antibody 50ug 774 € MBS Polyclonals_1 human
MBS623554 CCR7 (C-C Chemokine Receptor Type 7, Chemokine (C-C Motif) Receptor 7, C-C CKR-7, CC-CKR-7, CCR-7, BLR2, CD197, CDw197, CMKBR7, Epstein-Barr Virus-induced G-protein Coupled Receptor 1, EBV Induced G Protein Coupled Receptor 1, EBI1, EVI1, MIP-3 beta Recep Antibody 100ug 619 € MBS Polyclonals_1 virus
MBS622999 TRIM3 (Tripartite Motif Containing 3, Tripartite Motif-containing 3, Tripartite Motif Protein TRIM3, Brain Expressed Ring Finger, Brain-expressed Ring Finger, BERP, HAC1, Ring Finger Protein 22, RNF22, Ring Finger Protein 97, RNF97) 100ug 785 € MBS Polyclonals_1 human
MBS621891 TRIM56 (Tripartite Motif Containing 56, Tripartite Motif-containing 56, Tripartite Motif Containing Protein 56, DKFZp667O116, A130009K11Rik, FLJ35608, Gm452, MGC37358, OTTMUSP00000027392, RING Finger Protein 109, RNF109) 100ul 785 € MBS Polyclonals_1 human
GWB-BIG060 Recombinant Human CTACK (CCL27) bulk Ask price € genways bulk human
abx261537 Anti-CTACK (CCL27) Protein (Recombinant) 5 µg 238 € abbex human
abx261605 Anti-CTACK (CCL27) Protein (Recombinant) 20 µg 340 € abbex human
GWB-P1518J CCL27, 25-112aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BIG16B Recombinant Murine CTACK (CCL27) bulk Ask price € genways bulk human
C094 Recombinant Human C-C Motif Chemokine 1, CCL1 500 µg 1613 € novo human
CF47 Recombinant Human C-C Motif Chemokine 11, CCL11, Eotaxin 50 µg 339 € novo human
C439 Recombinant Human C-C Motif Chemokine 14, CCL14, HCC-3 (C-6His) 10 µg 156 € novo human
C064 Recombinant Human C-C Motif Chemokine 16, CCL16 50 µg 405 € novo human
C599 Recombinant Human C-C motif chemokine 17, CCL17 (C-6His) 10 µg 126 € novo human
CF38 Recombinant Human C-C Motif Chemokine 18, CCL18, PARC (N-6His) 10 µg 202 € novo human
CM78 Recombinant Human C-C Motif Chemokine 2, CCL2, MCP-1 500 µg 1755 € novo human